FedInvent™ Patents
Patent Details for Tuesday, August 22, 2006
This page was updated on Sunday, March 26, 2023 at 08:04 PM GMT
Department of Health and Human Services (HHS)
| US 07094358 | Norling et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The University of Texas System (Austin, Texas) |
| INVENTOR(S) | Barry K. Norling (San Antonio, Texas); Neera Satsangi (San Antonio, Texas) |
| ABSTRACT | Resin blends comprising liquid crystal monomers and secondary monomers useful to blend with liquid crystal monomers to maintain a nematic state under processing conditions while maintaining low cute shrinkage, particularly suitable for use in dental resin composites. |
| FILED | Thursday, March 07, 2002 |
| APPL NO | 10/093001 |
| ART UNIT | 1756 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Compositions 252/299.10 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094360 | Wellinghoff et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Southwest Research Institute (San Antonio, Texas) |
| INVENTOR(S) | Stephen T. Wellinghoff (San Antonio, Texas); Douglas P. Hanson (San Antonio, Texas) |
| ABSTRACT | A resin blend and method of producing the resin blend, the resin blend comprising one or more first liquid crystal monomer at a ratio to one or more secondary monomer, said secondary monomer and said ratio being adapted to maintain said resin blend in a nematic liquid crystalline state after addition of an inorganic filler at a temperature of 20° C. for about 30 minutes or more, the resin blend having a polymerization shrinkage of 3 vol. % or less. |
| FILED | Monday, December 13, 2004 |
| APPL NO | 11/010680 |
| ART UNIT | 1756 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Compositions 252/299.10 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094391 | Barbour et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The University of Texas System (Austin, Texas) |
| INVENTOR(S) | Alan G. Barbour (San Antonio, Texas); Catherine J. Luke (San Antonio, Texas) |
| ABSTRACT | Mucosal administration of OspA and compositions therefor are disclosed and claimed. More particularly, oral administration of OspA and compositions therefor for eliciting an immunological response against Borrelia burgdorferi, such as a protective response preventive of Lyme disease are disclosed and claimed. Thus, oral Lyme disease vaccines or immunological compositions and methods of use are disclosed and claimed. |
| FILED | Friday, January 19, 1996 |
| APPL NO | 08/588637 |
| ART UNIT | 1645 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/9.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094398 | Lieber et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Washington (Seattle, Washington) |
| INVENTOR(S) | André Lieber (Seattle, Washington); Dmitry M Shayakhmetov (Seattle, Washington); Denise R Farrer (Seattle, Washington); Thalia Papayannopoulou (Seattle, Washington); George Stamatoyannopoulos (Seatte, Washington) |
| ABSTRACT | The present invention provides for novel chimeric Ad-vectors carrying transgene, or portions of transgenes for stable and efficient gene transfer into diverse cell types or tissues in a CAR- and/or αυβ3/5-independent manner. Also provided are methods for producing such vectors and the use thereof for gene therapy to target a specific cell type or tissue. |
| FILED | Thursday, June 01, 2000 |
| APPL NO | 09/980564 |
| ART UNIT | 1633 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/93.200 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094404 | Waldmann |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Thomas A. Waldmann (Silver Spring, Maryland) |
| ABSTRACT | The present invention relates to a method for treating conditions associated with elevated levels of Tac-positive cells, including malignancy and autoimmune disorders and for preventing allograft rejection. 90Y-Conjugated anti-Tac or Ricin A conjugated anti-Tac and optionally unconjugated anti-Tac antibodies are employed to treat the above conditions. Clinical therapies have been designed to treat immune diseases and lymphomas in patients using conjugated anti-Tac antibodies. |
| FILED | Wednesday, June 07, 1995 |
| APPL NO | 08/478748 |
| ART UNIT | 1644 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/154.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094405 | Berzofsky et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Jay A. Berzofsky (Bethesda, Maryland); Jeffrey D. Ahlers (Kensington, Maryland); C. David Pendleton (Bethesda, Maryland); Peter Nara (Frederick, Maryland); Mutsunori Shirai (Kagawa, Japan) |
| ABSTRACT | Peptide constructs comprised of multideterminant T helper peptides from the envelope glycoprotein of HIV previously identified to induce proliferative responses in four different haplotypes of mice and IL-2 responses in 52-73% of HIV positive, flu positive patients (cluster peptides), were co-linearly synthesized with the peptide 18 of the V3 loop of HIV-1 gp 160, corresponding to the principal neutralizing determinant of HIV-IIIB and also shown to contain a dominant CTL epitope. Cognate help for peptide 18 antibody was elicited following a single immunization in all strains of mice which had previously responded to a T cell epitope encompassed by the peptides. In two strains of mice, the level of neutralizing antibody achieved was comparable to levels adequate for protection from homologous viral challenge in chimpanzees. After a single boost, much higher antibody titers for 90% neutralization in the range of 1:1000 to 1:16,000 were achieved. Spleen cells from mice of three distinct MHC haplotypes sharing the Dd class I MHC molecule but with different class II molecules, immunized with the compound peptides, exhibited enhanced gp160-specific CTL activity. |
| FILED | Monday, December 06, 1999 |
| APPL NO | 09/455076 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/188.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094406 | Reyes et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Department of Health and Human Services and Genelabs Technologies, Inc. (Washington, District of Columbia) |
| INVENTOR(S) | Gregory R. Reyes (Palo Alto, California); Patrice O. Yarbough (Union City, California); Daniel W. Bradley (Lawrenceville, Georgia); Krzysztof Z. Krawczynski (Norcross, Georgia); Albert W. Tam (San Francisco, California); Kirk E. Fry (Palo Alto, California) |
| ABSTRACT | Viral proteins derived from an enterically transmitted non-A/non-B viral hepatitis agent (HEV) are disclosed. In one embodiment, the protein is immunologically reactive with antibodies present in individuals infected with the viral hepatitis agent. This protein is useful in a diagnostic method for detecting infection by the enterically transmitted agent. Specific epitopes have been identified that are reactive with sera of individual infected with different strains of HEV. Also disclosed are DNA probes derived from a cloned sequence of the viral agent. These probes are useful for identifying and sequencing the entire viral agent and for assaying the presence of the viral agent in an infected sample, by using probe-specific amplification of virus-derived DNA fragments. |
| FILED | Monday, May 07, 2001 |
| APPL NO | 09/851410 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/189.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094408 | Franchini et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Genoveffa Franchini (Washington, District of Columbia); Zdenek Hel (Rockville, Maryland); George Pavlakis (Rockville, Maryland) |
| ABSTRACT | This invention relates to improved methods of inducing an immune response for the prevention or treatment of HIV-1 infection by using a nucleic acid vaccine in conjunction with a recombinant viral vaccine, e.g., a poxvirus vaccine, to potentiate and broaden the immune response. The present invention further provides a particularly effective vaccine regimen comprising a DNA vaccine used in combination with a poxvirus virus, especially NYVAC or ALVAC. |
| FILED | Monday, April 30, 2001 |
| APPL NO | 10/258570 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/192.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094410 | Reisfeld et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Scripps Research Institute (LaJolla, California) |
| INVENTOR(S) | Ralph A. Reisfeld (La Jolla, California); Andreas G. Niethammer (San Diego, California); Rong Xiang (San Diego, California) |
| ABSTRACT | A DNA vaccine effective for inhibiting endothelial cell proliferation comprises a DNA construct operably encoding a vascular endothelial growth factor (VEGF) receptor protein. This invention provides DNA vaccines that encode VEGF receptor-2 (KDR, SEQ ID NO: 2), VEGF receptor-1 (Flt-1, (SEQ ID NO: 4), or Flk-1 (the murine homolog of KDR, SEQ ID NO: 6), DNA sequences SEQ ID NOS: 1, 3, and 5 respectively, as well as methods of using such a DNA vaccine to inhibit vascular endothelial cell proliferation in the tumor micro-environment. Anti-angiogenesis and subsequent decrease in tumor growth and dissemination is achieved. |
| FILED | Saturday, March 02, 2002 |
| APPL NO | 10/090183 |
| ART UNIT | 1633 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/200.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094411 | Kinney et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Richard M. Kinney (Fort Collins, Colorado); Claire Y. H. Kinney (Fort Collins, Colorado); Duane J. Gubler (Fort Collins, Colorado); Siritorn Butrapet (Bangkok, Thailand); Natth Bhamarapravati (Bangkok, Thailand) |
| ABSTRACT | Chimeric flaviviruses that are avirulent and immunogenic are provided. The chimeric viruses are constructed to contain amino acid mutations in the nonstructural proteins of a flavivirus. Chimeric viruses containing the attenuation-mutated nonstructural genes of the virus are used as a backbone into which the structural protein genes of a second flavivirus strain are inserted. These chimeric viruses elicit pronounced immunogenicity yet lack the accompanying clinical symptoms of viral disease. The attenuated chimeric viruses are effective as immunogens or vaccines and may be combined in a pharmaceutical composition to confer simultaneous immunity against several strains of pathogenic flaviviruses. |
| FILED | Friday, February 16, 2001 |
| APPL NO | 10/204252 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/218.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094532 | Robertson et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Vanderbilt University (Nashville, Tennessee) |
| INVENTOR(S) | David Robertson (Nashville, Tennessee); Randy D. Blakely (Brentwood, Tennessee) |
| ABSTRACT | Isolated polynucleotide molecules and peptides encoded by these molecules are used in the analysis of human norepinephrine (NE) transporter variants, as well as in diagnostic and therapeutic applications, relating to a human NE transporter polymorphism. By analyzing genomic DNA or amplified genomic DNA, or amplified cDNA derived from mRNA, it is possible to type a human NE transporter with regard to the human NE transporter polymorphism, for example, in the context of diagnosing and treating NE transport impairments, and disorders associated with NE transport impairments, such as orthostatic intolerance. |
| FILED | Thursday, December 28, 2000 |
| APPL NO | 09/750609 |
| ART UNIT | 1637 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/6 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094533 | Lin |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Board of Regents of the University of Nebraska (Omaha, Nebraska) |
| INVENTOR(S) | Ming-Fong Lin (Omaha, Nebraska) |
| ABSTRACT | Presented is a therapeutic method to treat prostate carcinomas in mammals comprising the administration of cellular PAcP protein. Also presented is a method to diagnose androgen-insensitive prostate carcinomas by determining the expression level of cellular PAcP in the prostate carcinomas, a decrease in expression being indicative of androgen-insensitivity. A promoter region that is specifically expressed in prostate tissue is presented, as is a xenograft animal mode that mimics human prostate carcinomas in the expression of cellular PAcP. |
| FILED | Friday, January 21, 2000 |
| APPL NO | 09/889630 |
| ART UNIT | 1634 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/6 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094547 | Hao et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Virginia Patent Foundation (Charlottesville, Virginia) |
| INVENTOR(S) | Zhonglin Hao (Charlottesville, Virginia); John C. Herr (Charlottesville, Virginia); Friederike L. Jayes (Cary, North Carolina); Jagathpala Shetty (Charlottesville, Virginia); Michael J. Wolkowicz (Charlottesville, Virginia) |
| ABSTRACT | The present invention relates to sperm specific surface proteins, nucleic acid sequences encoding those proteins and antibodies raised against those proteins. Compositions comprising the sperm specific proteins or inhibitors of said proteins can be used in contraceptive applications. |
| FILED | Thursday, March 25, 2004 |
| APPL NO | 10/809655 |
| ART UNIT | 1653 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/6 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094553 | Prusiner et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California); The Scripps Research Institute (La Jolla, California) |
| INVENTOR(S) | Stanley B. Prusiner (San Francisco, California); Jiri G. Safar (Walnut Creek, California); R. Anthony Williamson (San Diego, California); Dennis R. Burton (La Jolla, California) |
| ABSTRACT | The present invention provides antibodies that specifically bind with a high degree of binding affinity to a native ungulate PrPC and/or a denatured ungulate PrPSc, but not to a native ungulate PrPSc. Preferred antibodies find native bovine PrPC and treated PrPSc but not native bovine PrPSc and can be used in an assay to determine if a sample is infected with infectious prions, i.e. PrPSc. |
| FILED | Thursday, January 30, 2003 |
| APPL NO | 10/355780 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/7.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094555 | Kwok et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Benaroya Research Institute at Virginia Mason (Seattle, Washington) |
| INVENTOR(S) | William W. Kwok (Bellevue, Washington); Gerald Nepom (Bainbridge, Washington); John Gebe (Bothell, Washington); Helena Reijonen (Seattle, Washington); Andrew Liu (Seattle, Washington) |
| ABSTRACT | The present invention provides of using multimeric MHC class II/peptide complexes. In one aspect, methods provided for identifying MHC class II-restricted immune epitopes of a predetermined polypeptide antigen. Methods for identifying an immunostimulatory epitope for a predetermined polypeptide antigen are provided. In a related aspect, methods for screening a therapeutic polypeptide agent for an MHC class II epitope are provided. In other aspects, methods for modulating T cells and for determining or monitoring an MHC class II-restricted immune status of a patient are also provided. |
| FILED | Friday, April 05, 2002 |
| APPL NO | 10/116846 |
| ART UNIT | 1639 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/7.200 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094556 | Wands et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Rhode Island Hospital (Providence, Rhode Island) |
| INVENTOR(S) | Jack R. Wands (Waban, Massachusetts); Suzanne M de la Monte (East Greenwich, Rhode Island); Nedim Ince (Boston, Massachusetts); Rolf I. Carlson (Waban, Massachusetts) |
| ABSTRACT | The invention features a method for diagnosing a malignant neoplasm in a mammal by contacting a bodily fluid from the mammal with an antibody which binds to an human aspartyl (asparaginyl) beta-hydroxylase (HAAH) polypeptide and methods of treating malignant neoplasms by inhibiting HAAH. |
| FILED | Wednesday, July 11, 2001 |
| APPL NO | 09/903023 |
| ART UNIT | 1642 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/7.230 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094576 | Tsang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Victor C. W. Tsang (Decatur, Georgia); Ryan M. Greene (San Antonio, Texas); Patricia P. Wilkins (Gainesville, Georgia); Kathy Hancock (Atlanta, Georgia) |
| ABSTRACT | Compositions and methods for the detection of Taenia solium and the diagnosis of T. solium infection are described. The nucleotide and amino acid sequences of the antigenic T. solium polypeptides gp50a, gp50b and gp50c are provided. The compositions contain synthetic antigenic polypeptides of larval origin prepared using the sequences described herein. Probes and primers for the detection or amplification of T. solium nucleic acid molecules are also described. The polypeptides can be administered to a human or animal to protect against T. solium infection. In addition, the polypeptides are useful as research tools for studying T. solium and as reagents in assays for the detection of T. solium antibodies in a biological sample. The methods are sensitive and specific assays that utilize the stable recombinant or synthetic antigenic polypeptides or nucleic acid molecules encoding the larval polypeptides. |
| FILED | Friday, March 30, 2001 |
| APPL NO | 10/240982 |
| ART UNIT | 1645 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/69.300 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094581 | Weigel et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Board of Regents of the University of Oklahoma (Norman, Oklahoma) |
| INVENTOR(S) | Paul H. Weigel (Edmond, Oklahoma); Kshama Kumari (Edmond, Oklahoma) |
| ABSTRACT | A functionally active hyaluronan synthase having at least one modified amino acid residue therein as compared to a corresponding functionally active native hyaluronan synthase such that the functionally active hyaluronan synthase has an altered enzymatic activity as compared to the corresponding functionally active native hyaluronan synthase is disclosed. Methods of producing hyaluronic acid utilizing a recombinant host cell having an expression construct encoding the functionally active hyaluronan synthase with altered enzymatic activity are also disclosed. |
| FILED | Tuesday, December 03, 2002 |
| APPL NO | 10/309560 |
| ART UNIT | 1653 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/84 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094597 | Carson et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Dennis A. Carson (Del Mar, California); Salvatore Albani (Encinitas, California) |
| ABSTRACT | Vaccine compositions useful in inducing immune protection in a host against arthritogenic peptides involved in the pathogenesis of rheumatoid arthritis are disclosed. Each vaccine composition provides antigenic dnaJp1 peptide (by including the peptide or a polynucleotide which encodes the peptide) and, optionally, other peptide fragments of the microbial dnaJ protein and/or human homologs thereof. Methods for identifying persons who are predisposed to develop rheumatoid arthritis and methods for use of the inventive vaccines are also disclosed. |
| FILED | Friday, July 14, 2000 |
| APPL NO | 09/616247 |
| ART UNIT | 1645 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/320.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094598 | Nabel et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Gary J. Nabel (Washington, District of Columbia); Zhi-yong Yang (Potomac, Maryland) |
| ABSTRACT | The present invention relates generally to viral vaccines and, more particularly, to filovirus vaccines and methods of eliciting an immune response against a filovirus or disease caused by infection with filovirus. |
| FILED | Wednesday, November 24, 2004 |
| APPL NO | 10/997120 |
| ART UNIT | 1633 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/320.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094599 | Seed et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The General Hospital Corporation (Boston, Massachusetts) |
| INVENTOR(S) | Brian Seed (Boston, Massachusetts); Babak Banapour (Boston, Massachusetts); Charles Romeo (Belmont, Massachusetts); Waldemar Kolanus (Watertown, Massachusetts) |
| ABSTRACT | Disclosed is a method of directing a cellular immune response against an HIV-infected cell in a mammal involving administering to the mammal an effective amount of therapeutic cells which express a membrane-bound, proteinaceous chimeric receptor comprising (a) an extracellular portion which includes a fragment of CD4 which is capable of specifically recognizing and binding the HIV-infected cell but which does not mediate HIV infection and (b) an intracellular portion which is capable of signalling the therapeutic cell to destroy the receptor-bound HIV-infected cell. Also disclosed are cells which express the chimeric receptors and DNA and vectors encoding the chimeric receptors. |
| FILED | Friday, August 24, 2001 |
| APPL NO | 09/939537 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/328 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094600 | Wang |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Research Foundation of State University of New York (Albany, New York) |
| INVENTOR(S) | Sho-Ya Wang (Voorheesville, New York) |
| ABSTRACT | A method or screen for assessing the potential of a compound to treat a pathological condition, such as arrhythmia, which is manifested by an increased late sodium current in a heart is disclosed. The method employs a mutant sodium channel protein having an amino acid sequence in which one or more amino acids among the ten amino acids occurring at the carboxy end of the S6 segments of D1, D2, D3 or D4 domains of mammalian Nav1 differs from the amino acid in wild-type Nav1 by substitution with tryptophan, phenylalanine, tyrosine or cysteine. Cells transfected with a nucleic acid that encodes a mutant mammalian Nav1 protein, as well as isolated nucleic acids comprising a nucleotide sequence that codes for a mutant mammalian Nav1 protein are disclosed. |
| FILED | Friday, August 13, 2004 |
| APPL NO | 10/918332 |
| ART UNIT | 1646 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/369 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094604 | Snyder et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Florida Research Foundation, Inc. (Gainesville, Florida) |
| INVENTOR(S) | Richard O. Snyder (Gainesville, Florida); Sergei Zolotukhin (Gainesville, Florida); Yoshihisa Sakai (Gainesville, Florida); Barry J. Byrne (Gainesville, Florida); Mark R. Potter (Gainesville, Florida); Irine Zolotukhin (Gainesville, Florida); Scott Loiler (Gainesville, Florida); Vince A. Chiodo (Gainesville, Florida); Nicholas Muzyczka (Gainesville, Florida); William W. Hauswirth (Gainesville, Florida); Terence R. Flotte (Alachua, Florida); Corinna Burger (Gainesville, Florida); Edgardo Rodriguez (Gainesville, Florida); Kevin R. Nash (Gainesville, Florida); Thomas J. Fraites (Gainesville, Florida) |
| ABSTRACT | Vectors that encode Adeno-Associated Virus (AAV) Rep and Cap proteins of different serotypes and Adenovirus transcription products that provide helper functions were used to produce pseudotyped recombinant AAV (rAAV) virions. Purification methods generated pseudotyped rAAV virion stocks that were 99% pure with titers of 1×1012–1×1013 vector genomes/ml. |
| FILED | Thursday, March 11, 2004 |
| APPL NO | 10/798192 |
| ART UNIT | 1636 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/457 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094758 | Wang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Board of Regents, The University of Texas System (Austin, Texas) |
| INVENTOR(S) | Xiaodong Wang (Dallas, Texas); Chunying Du (Dallas, Texas) |
| ABSTRACT | The invention provides methods and compositions for enhancing apoptosis of pathogenic cells. The general method comprises the of contacting the cells with an effective amount of an AV peptoid, wherein the AV peptoid is a peptide comprising AX1, wherein X1 is V, I or L, or a peptide mimetic thereof, which interacts with an Inhibitor of Apoptosis protein (IAP) as measured by IAP binding, procaspase-3 activation or promotion of apoptosis, wherein apoptosis of the pathogenic cells is enhanced. The subject compositions encompass pharmaceutical compositions comprising a therapeutically effective amount of a subject AV peptoid in dosage form and a pharmaceutically acceptable carrier, wherein the AV peptoid is a peptide comprising AX1, wherein X1 is V, I or L, or a peptide mimetic thereof, which inhibits the activity of an Inhibitor of Apoptosis protein (IAP) as measured by IAP binding, procaspase-3 activation or promotion of apoptosis. The invention also provides assays for identifying agents which modulates the interaction of an AV peptoid with an IAP, active compounds identified in such screens and their use in the foregoing compositions and therapeutic methods. |
| FILED | Monday, December 05, 2005 |
| APPL NO | 11/294968 |
| ART UNIT | 1653 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/12 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094772 | Hostetler et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Karl Y. Hostetler (Del Mar, California); James R. Beadle (San Diego, California); Ganesh D. Kini (Bristow, Virginia) |
| ABSTRACT | The present invention relates to phosphonate compounds, compositions containing them, processes for obtaining them, and their use for treating a variety of medical disorders, e.g., osteoporosis and other disorders of bone metabolism, cancer, viral infections, and the like. |
| FILED | Wednesday, April 06, 2005 |
| APPL NO | 11/100882 |
| ART UNIT | 1626 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/110 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094774 | DeLuca et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Wisconsin Alumni Research Foundation (Madison, Wisconsin) |
| INVENTOR(S) | Hector F. DeLuca (Deerfield, Wisconsin); Rafal R. Sicinski (Warsaw, Poland) |
| ABSTRACT | This invention provides a novel class of vitamin D related compounds, namely, the 2-alkylidene-19-nor-vitamin D derivatives, as well as a general method for their chemical synthesis. The compounds have the formula: where Y1 and Y2, which may be the same or different, are each selected from the group consisting of hydrogen and a hydroxy-protecting group, R6 and R8, which may be the same or different, are each selected from hydrogen, alkyl, hydroxyalkyl and fluoroalkyl, or when taken together represent the group —(CH2)x— where x is an integer from 2 to 5, and where the group R represents any of the typical side chains known for vitamin D type compounds. These 2-substituted compounds are characterized by relatively high intestinal calcium transport activity and relatively high bone calcium mobilization activity resulting in novel therapeutic agents for the treatment of diseases where bone formation is desired, particularly low bone turnover osteoporosis. These compounds also exhibit pronounced activity in arresting the proliferation of undifferentiated cells and inducing their differentiation to the monocyte thus evidencing use as anti-cancer agents and for the treatment of diseases such as psoriasis. |
| FILED | Tuesday, February 17, 2004 |
| APPL NO | 10/780103 |
| ART UNIT | 1616 — Organic Compounds: Bio-affecting, Body Treating, Drug Delivery, Steroids, Herbicides, Pesticides, Cosmetics, and Drugs |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/167 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094776 | DeLuca et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Wisconsin Alumni Research Foundation (Madison, Wisconsin) |
| INVENTOR(S) | Hector F. DeLuca (Deerfield, Wisconsin); Rafal R. Sicinski (Warsaw, Poland) |
| ABSTRACT | A method of modifying or altering the structure of a 1α-hydroxylated vitamin D compound to increase its biological activity by altering the conformational equilibrium of the A-ring to favor a chair conformation that presents the 1α-hydroxyl in the axial orientation. This is accomplished by either locking the A-ring chair conformation in a geometry having an axially orientated 1α-hydroxyl, or by the addition of one or more substituents to the A-ring which interact with other substituents in the molecule or on the A-ring to provide a driving force to the A-ring to adopt a chair conformation which presents the 1α-hydroxyl in the axial orientation. |
| FILED | Friday, March 18, 2005 |
| APPL NO | 11/083628 |
| ART UNIT | 1616 — Organic Compounds: Bio-affecting, Body Treating, Drug Delivery, Steroids, Herbicides, Pesticides, Cosmetics, and Drugs |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/167 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094805 | Danishefsky et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Trustees of Columbia University in the City of New York (New York, New York) |
| INVENTOR(S) | Samuel J. Danishefsky (Englewood, New Jersey); Vladimir B. Birman (New York, New York) |
| ABSTRACT | This invention provides a total synthesis of Merrillactone and Merrilactone analogues for use as neurotrophic agents in the treatment of neurodegenerative diseases. The invention also provides intermediates for use in the synthesis of Merrilactone and its analogues. |
| FILED | Friday, December 13, 2002 |
| APPL NO | 10/318777 |
| ART UNIT | 1626 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/463 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094808 | Bergeron, Jr. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Florida Research Foundation, Inc. (Gainesville, Florida) |
| INVENTOR(S) | Raymond J. Bergeron, Jr. (Gainesville, Florida) |
| ABSTRACT | Polyamines having the formula: or a salt thereof with a pharmaceutically acceptable acid wherein: R1-R6 may be the same or different and are alkyl, aryl, aryl alkyl, cycloalkyl, optionally having an alkyl chain interrupted by at least one etheric oxygen atom, or hydrogen; N1, N2, N3 and N4 are nitrogen atoms capable of protonation at physiological pH's; a and b may be the same or different and are integers from 1 to 4; A, B and C may be the same or different and are bridging groups which effectively maintain the distance between the nitrogen atoms such that the polyamines: (i) are capable of uptake by a target cell upon administration thereof to a human or non-human animal; and (ii) upon uptake by the target cell, competitively bind via an electrostatic interaction between the positively charged nitrogen atoms to substantially the same biological counter-anions as the intracellular natural polyamines in the target cell; the polyamines, upon binding to the biological counter-anion in the cell, function in a manner biologically different than the intracellular polyamines, the polyamines not occurring in nature; as well as pharmaceutical compositions embodying the polyamines and methods of treating patients requiring anti-neoplastic therapy. |
| FILED | Wednesday, September 04, 2002 |
| APPL NO | 10/233400 |
| ART UNIT | 1626 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/673 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094873 | Patterson et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Board of Regents, The University of Texas System (Austin, Texas) |
| INVENTOR(S) | Winston Campbell Patterson (Chapel Hill, North Carolina); Carol A. Ballinger (Santa Fe, Texas) |
| ABSTRACT | An isolated polypeptide having negative regulating activity for a heat shock protein is provided. Also provided is an isolated nucleic acid encoding the polypeptide of the invention, methods for identifying inhibitors of the polypeptide and recombinant preparation of the polypeptide. Also provided are compositions such as inhibitor compositions. |
| FILED | Wednesday, May 17, 2000 |
| APPL NO | 09/573473 |
| ART UNIT | 1643 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/350 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094878 | Lee et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | President and Fellows of Harvard College (Cambridge, Massachusetts) |
| INVENTOR(S) | Mu-En Lee (Newton, Massachusetts); Matthew D. Layne (Brighton, Massachusetts); Shaw-Fang Yet (Andover, Massachusetts) |
| ABSTRACT | The invention features a aortic carboxypeptidase-like polypeptide (ACLP), DNA encoding ACLP, and methods of detecting genetic alterations associated with abdominal wall defects. |
| FILED | Tuesday, September 10, 2002 |
| APPL NO | 10/238876 |
| ART UNIT | 1647 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/350 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094880 | Höök et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Texas A and M University System (College Station, Texas) |
| INVENTOR(S) | Magnus Höök (Houston, Texas); Tracey A. Dugan (Houston, Texas) |
| ABSTRACT | The present invention provides compositions and methods of inhibiting fibrin(ogen) clot formation by utilizing decorin proteoglycan as an anticoagulating and antithrombotic agent. The decorin proteoglycan comprises a decorin core protein or a fragment thereof covalently linked to a galactosaminoglycan polysaccharide. The decorin core protein acts as an anticoagulant and as a carrier for the delivery of an antithrombotic galactosaminoglycan to fibrinogen. Fibrin clotting is inhibited by the decorin proteoglycan in a concentration-dependent fashion. |
| FILED | Monday, July 26, 2004 |
| APPL NO | 10/898841 |
| ART UNIT | 1653 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/350 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094886 | Shaughnessy |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Board of Trustees of the University of Arkansas (Little Rock, Arkansas) |
| INVENTOR(S) | John D. Shaughnessy (Little Rock, Arkansas) |
| ABSTRACT | The present invention describes the cloning and molecular and cellular characterization of a novel protein with homology to the IL-17 receptor. The gene was cloned by virtue of its proximity to a common site of retroviral integration in a murine acute myeloid leukemia. The gene described herein possibly codes for a novel interleukin receptor that binds an as yet unidentified cytokine ligand, and may be useful in cancer diagnostics and therapies that rely on immune system modulation. |
| FILED | Friday, February 02, 2001 |
| APPL NO | 09/778971 |
| ART UNIT | 1642 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Organic compounds 536/23.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094892 | Cadet et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Research Foundation of State University of New York (Albany, New York) |
| INVENTOR(S) | Patrick Cadet (Elmont, New York); George B. Stefano (Melville, New York) |
| ABSTRACT | The invention provides isolated nucleic acid molecules, host cells that contain an isolated nucleic acid molecule, and substantially pure polypeptides. For example, the invention provides isolated nucleic acid molecules that encode polypeptides having mu3 opiate receptor activity, host cells that contain an isolated nucleic acid molecule that encodes a polypeptide having mu3 opiate receptor activity, and substantially pure polypeptides that have mu3 opiate receptor activity. In addition, the invention provides methods and materials for identifying mu3 opiate receptor agonists and antagonists. |
| FILED | Friday, February 22, 2002 |
| APPL NO | 10/080917 |
| ART UNIT | 1647 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Organic compounds 536/24.310 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094945 | Solomon et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Northwestern University (Evanston, Illinois) |
| INVENTOR(S) | Aaron Solomon (Evanston, Illinois); Richard Morimoto (Evanston, Illinois); Greg Beitel (Wilmette, Illinois) |
| ABSTRACT | The present invention relates to water-stress tolerance, in particular to the OSR-1 (osmotic stress resistant-1) protein, and nucleic acids encoding the OSR-1 protein. The present invention provides assays for the detection of OSR-1, and polymorphisms and mutations associated with water stress tolerance. In particular, the present invention relates to compositions comprising small interfering RNA duplexes (RNAi), or vectors that encode dsRNA, that inhibit expression of the OSR-1 gene (e.g. by targeting OSR-1 mRNA), and methods of using these compositions to impair deleterious nematodes. |
| FILED | Tuesday, December 16, 2003 |
| APPL NO | 10/736868 |
| ART UNIT | 1633 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Multicellular living organisms and unmodified parts thereof and related processes 8/8 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095016 | Oser et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | SRI International (Menlo Park, California) |
| INVENTOR(S) | Harald Oser (Menlo Park, California); Michael J. Coggiola (Sunnyvale, California); Steven E. Young (Mountain View, California); David R. Crosley (Palo Alto, California) |
| ABSTRACT | A method and apparatus are provided for analyzing an analyte at low concentration in a liquid sample by photoionization and mass spectrometry. An inlet system is provided for direct injection of the liquid sample using a capillary tube. The method and apparatus allow for 20 to 2000-fold improvement of the lower detection limit of an analyte in a liquid sample compared to a conventional liquid chromatography/mass spectrometer apparatus. |
| FILED | Thursday, April 29, 2004 |
| APPL NO | 10/836644 |
| ART UNIT | 2881 — Optics |
| CURRENT CPC | Radiant energy 250/288 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095019 | Sheehan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Chem-Space Associates, Inc. (Pittsburgh, Pennsylvania) |
| INVENTOR(S) | Edward W Sheehan (Pittsburgh, Pennsylvania); Ross C Willoughby (Pittsburgh, Pennsylvania) |
| ABSTRACT | An improved ion source and portable analyzer for collecting and focusing dispersed gas-phase ions from a reagent source at atmospheric or intermediate pressure, having a remote source of reagent ions generated by direct or alternating currents, separated from a low-field sample ionization region by a stratified array of elements, each element populated with a plurality of openings, wherein DC potentials are applied to each element necessary for transferring reagent ions from the remote source into the low-field sample ionization region where the reagent ions react with neutral and/or ionic sample forming ionic species. The resulting ionic species are then introduced into the vacuum system of a mass spectrometer or ion mobility spectrometer. Embodiments of this invention are methods and devices for improving sensitivity of mass spectrometry when gas and liquid chromatographic separation techniques or probes containing samples are coupled to atmospheric and intermediate pressure photo-ionization, chemical ionization, and thermospray ionization sources. |
| FILED | Monday, May 02, 2005 |
| APPL NO | 11/120363 |
| ART UNIT | 2881 — Optics |
| CURRENT CPC | Radiant energy 250/288 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095502 | Lakowicz et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | |
| INVENTOR(S) | Joseph Lakowicz (Ellicott City, Maryland); Zygmunt Gryczynski (Ellicott City, Maryland); Chris Geddes (Baltimore, Maryland) |
| ABSTRACT | The present invention is directed to optical structures and methods detecting the fluorescence of a molecule using metal-enhanced fluorescence. In particular, the invention describes the use of surface plasmon excitation for excitation of fluorophores near the metal surface and the efficient collection of the emission by coupling into the plasmon resonance and directing towards the detector. More particularly, the present invention makes use of the unique directionality of the plasmon induced fluorescence signal. The present invention is directed to optical structures using metal enhanced fluorescence including: an optical fiber having a conductive external coating; a light emitting diode (LED) having a conical shaped depression with curved sides on a front end surface, the curved sides having a conducting coating on the outer surface with respect to the LED. |
| FILED | Tuesday, August 05, 2003 |
| APPL NO | 10/633715 |
| ART UNIT | 2877 — Optics |
| CURRENT CPC | Optics: Measuring and testing 356/445 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07096056 | Miller et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Board of Trustees of the Leland Stanford Junior University (Palo Alto, California) |
| INVENTOR(S) | Karla L. Miller (San Francisco, California); John M. Pauly (Redwood City, California) |
| ABSTRACT | A method for functional magnetic resonance imaging (fMRI) uses steady-state free precession (SSFP) to image changes in blood oxygenation between two time periods. A center frequency of the SSFP sequence is placed between the different resonant frequencies for oxyhemoglobin and deoxyhemoglobin whereby the signals have a phase difference of 180° and tend to cancel. By repeating the SSFP imaging sequence at different times, the difference in the measured signals provides a measure of change in oxyhemoglobin. RF flip angle of the SSFP sequence is chosen to maximize signal level in the frequency range from that of water in the presence of oxyhemoglobin and that of water in the presence of deoxyhemoglobin. |
| FILED | Monday, June 16, 2003 |
| APPL NO | 10/463008 |
| ART UNIT | 3737 — Optics |
| CURRENT CPC | Surgery 6/410 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07096328 | Yao et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Southern California (Los Angeles, California) |
| INVENTOR(S) | Shu-Yuen Didi Yao (Los Angeles, California); Cyrus Shahabi (Irvine, California); Roger Zimmermann (Walnut, California) |
| ABSTRACT | Systems and techniques to pseudorandomly place and redistribute data blocks in a storage system. In general, in one implementation, the techniques include: distributing data blocks over multiple storage devices according to a reproducible pseudorandom sequence that provides load balancing across the storage devices, and determining current storage locations of the data blocks by reproducing the pseudorandom sequence. The techniques may also include: distributing data blocks over multiple storage devices according to a reproducible pseudorandom sequence, in response to initiation of a storage scaling operation, pseudorandomly redistributing a selected subset of the data blocks and saving information describing the storage scaling operation, determining current storage locations based on the pseudorandom sequence and the saved scaling operation information, and accessing the data blocks according to the determined current storage locations. |
| FILED | Friday, January 24, 2003 |
| APPL NO | 10/351269 |
| ART UNIT | 2187 — Computer Architecture and I/O |
| CURRENT CPC | Electrical computers and digital processing systems: Memory 711/157 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Defense (DOD)
| US 07093418 | Morris et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Honeywell International, Inc. (Morristown, New Jersey) |
| INVENTOR(S) | Mark C. Morris (Phoenix, Arizona); Alan G. Tiltman (Fountain Hills, Arizona); Kin Poon (Tempe, Arizona); Bradley A. Volkmann (Phoenix, Arizona) |
| ABSTRACT | A gas turbine engine is configured to use relatively cool, low pressure air discharged from a low pressure compressor to supply buffer air to lubrication sump seals. The engine is further configured such that the lubrication sump is thermally layered by isolating relatively hot, high pressure compressor air from the sump by utilizing a warm vent mixing cavity, which is located radially between of the hot high pressure compressor air and the cool buffer air, which is located in a buffer cavity between the vent cavity and the sump. |
| FILED | Wednesday, April 21, 2004 |
| APPL NO | 10/830265 |
| ART UNIT | 3746 — Thermal & Combustion Technology, Motive & Fluid Power Systems |
| CURRENT CPC | Power plants 060/39.80 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07093419 | McCaffrey et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | General Electric Company (Schenectady, New York) |
| INVENTOR(S) | Timothy P. McCaffrey (Swampscott, Massachusetts); Stephen John Howell (West Newbury, Massachusetts); John Carl Jacobson (Melrose, Massachusetts); Barry Francis Barnes (Malden, Massachusetts) |
| ABSTRACT | A method facilitates assembling a gas turbine engine. The method comprises coupling a combustor including a dome assembly and a combustor liner that extends downstream from the dome assembly to a combustor casing that is positioned radially outwardly from the combustor, coupling a ring support that includes a first radial flange, a second radial flange, and a plurality of beams that extend therebetween to the combustor casing, and coupling a primer nozzle including an injection tip to the combustor such that the primer nozzle extends axially through the dome assembly such that fuel may be discharged from the primer nozzle into the combustor during engine start-up operating conditions. |
| FILED | Wednesday, July 02, 2003 |
| APPL NO | 10/613641 |
| ART UNIT | 3746 — Thermal & Combustion Technology, Motive & Fluid Power Systems |
| CURRENT CPC | Power plants 060/39.94 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07093440 | Howell et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | General Electric Company (Schenectady, New York) |
| INVENTOR(S) | Stephen John Howell (West Newbury, Massachusetts); Barry Francis Barnes (Milford, Connecticut); Timothy Patrick McCaffrey (Swampscott, Massachusetts); John Carl Jacobson (Melrose, Massachusetts) |
| ABSTRACT | An outer combustor wall (36) includes an outer support shell (40) surrounding an outer combustion liner (42). The shell (40) includes a first radial aft flange (46), and the liner (42) includes a second radial aft flange (48) axially adjoining the first flange. An annular retainer (50) and seal (62) are joined to the first flange for slidingly trapping the second flange therebetween for thermally floating the liner on the shell. |
| FILED | Wednesday, June 11, 2003 |
| APPL NO | 10/458854 |
| ART UNIT | 3746 — Thermal & Combustion Technology, Motive & Fluid Power Systems |
| CURRENT CPC | Power plants 060/752 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07093448 | Nguyen et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Honeywell International, Inc. (Morristown, New Jersey) |
| INVENTOR(S) | Ly D. Nguyen (Phoenix, Arizona); Gregory O. Woodcock (Mesa, Arizona); Stony Kujala (Tempe, Arizona) |
| ABSTRACT | A gas turbine engine comprises a turbine scroll inside a combustor housing, discouragers with 90-degree bending angles, a radial nozzle contacting a forward bayonet on the forward side of the turbine scroll at a bayonet engagement point and a B-width measured between the discouragers. Retaining ring maintains the size of the B-width. The turbine scroll may have eight surfaces sealing at four locations and a provision to maintain constant “B-width” for the thin sheet metal scroll within the combustion system. The design allows the scroll to operate at high temperature while maintaining lowest possible thermal and mechanical stresses. It can be easily assembled with excellent capability to control gas leakage and minimal component interface wearing or fretting. The gas turbine engine is adapted for aircraft, spacecraft, missiles, and other flight vehicles, especially high performance, high cycle flight vehicles. |
| FILED | Wednesday, October 08, 2003 |
| APPL NO | 10/682217 |
| ART UNIT | 3746 — Thermal & Combustion Technology, Motive & Fluid Power Systems |
| CURRENT CPC | Power plants 060/798 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07093504 | Southward |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | LORD Corporation (Cary, North Carolina) |
| INVENTOR(S) | Steve C. Southward (Apex, North Carolina) |
| ABSTRACT | The invention provides a method/system for measuring torque. The method/system includes providing a first rotating disk having a target pattern and providing a second rotating disk having a target pattern. The method/system includes providing a first set of at least three sensors, comprised of a first disk first sensor, a first disk second sensor, and a first disk third sensor, the first set of at least three sensors for sensing the first rotating disk target pattern with the first set of at least three sensors fixed around and encompassing the first rotating disk. The method/system includes providing a second set of at least three sensors, comprised of a second disk first sensor, a second disk second sensor, and a second disk third sensor, the second set of at least three sensors for sensing the second rotating disk target pattern, with the second set of at least three sensors fixed around and encompassing the second rotating disk. The method/system includes measuring an apparent twist of the first rotating disk relative to the second rotating disk with the first set of at least three sensors and the second set of at least three sensors, and determining an actual twist angle from the measured apparent twist. |
| FILED | Friday, August 27, 2004 |
| APPL NO | 10/928340 |
| ART UNIT | 2855 — Printing/Measuring and Testing |
| CURRENT CPC | Measuring and testing 073/862.80 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07093626 | Li et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Ovonic Hydrogen Systems, LLC (Rochester Hills, Michigan) |
| INVENTOR(S) | Yang Li (Troy, Michigan); Charles Stahl (Algonac, Michigan); Ned Stetson (Lake Orion, Michigan); Daniel Bovinich (Rochester Hills, Michigan) |
| ABSTRACT | A mobile hydrogen delivery system for delivering a compressed stream of hydrogen at pressures up to 15000 psig. The mobile hydrogen delivery system includes a hydrogen compression system, a gaseous hydrogen storage system, and a delivery system for supplying hydrogen to end users. A mobile platform supports the hydrogen compression system, the gaseous hydrogen storage system, and the dispensing system. The mobile platform may be any platform, such as a trailer, capable of being pulled, pushed, or supported by any type of vehicle, such a truck, train, boat, tractor, etc. |
| FILED | Monday, December 06, 2004 |
| APPL NO | 11/005582 |
| ART UNIT | 3751 — Printing/Measuring and Testing |
| CURRENT CPC | Fluent material handling, with receiver or receiver coacting means 141/231 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07093787 | Garrettson et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | United Technologies Corporation (Hartford, Connecticut) |
| INVENTOR(S) | Brook Garrettson (San Jose, California); Hugh M. Reynolds (San Jose, California); James P. Hornick (San Jose, California) |
| ABSTRACT | A lightning strike mitigation system for protecting a surface includes an inner insulating layer adjacent a surface to be protected, an outer insulating layer, and an intermediate layer formed from an electrically conductive material between the inner and outer insulating layers. The inner and outer insulating layers may be formed from an ablative insulating material containing no metal fill, an ablative insulating material containing a 15% Ni fill, or an ablative insulating material containing a 30% Ni fill. The electrically conductive material may be a mesh material or a foil material formed from an electrically conductive material or materials. |
| FILED | Monday, April 28, 2003 |
| APPL NO | 10/424435 |
| ART UNIT | 3641 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Aeronautics and astronautics 244/1.A00 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07093909 | Korpi et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Army (Washington, District of Columbia) |
| INVENTOR(S) | John G Korpi (Livonia, Michigan); Michael J Manceor (Troy, Michigan) |
| ABSTRACT | There is disclosed herein a visual and thermal shield system that effectively obscures visual indicators and thermal signatures of wheel assemblies of a military vehicle to thereby address longstanding military concerns for vehicle and crew survivability. Our device is spaced outboard from the wheel and tire to maintain an insulating body of air between said shield and the adjacent axle, hub, wheel, and tire. Expeditiously, this invention also affords substantial eclipse of the complete tire profile. If a plurality of wheels exist on said vehicle, then multiple shields of this invention can be used to hinder vehicle identification and potential designation of its military purpose. |
| FILED | Friday, June 13, 2003 |
| APPL NO | 10/460817 |
| ART UNIT | 3617 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Land vehicles: Wheels and axles 31/37.250 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094024 | Nguyen et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Honeywell International, Inc. (Morristown, New Jersey) |
| INVENTOR(S) | Ly D. Nguyen (Phoenix, Arizona); Lori M. Wheeler (Scottsdale, Arizona); Greg Ockenfels (Phoenix, Arizona); Darrell K. James (Chandler, Arizona); George E. Zurmehly (Phoenix, Arizona) |
| ABSTRACT | An integral assembly that may improve control over thermal and mechanical behaviors of assembly structures during various transient operation conditions is disclosed. The integral assembly comprises a continuous ring disposed coaxial with, and orthogonal to a central axis, the continuous ring comprising a plurality of surfaces, the plurality of surfaces having a continuous outer surface and a continuous inner surface; the plurality of surfaces being characterized by a continuous cross section having a first cross sectional dimension longitudinally disposed parallel to the central axis; the plurality of surfaces comprising a bell mouth surface in physical communication with a compressor shroud surface; the compressor shroud surface being in physical communication with a diffuser surface; and the diffuser surface being in physical communication with the bell mouth surface. The integral assembly comprising a compressor shroud is also provided. An auxiliary power unit including the integral assembly, and a method of making the integral assembly are also disclosed. |
| FILED | Thursday, January 15, 2004 |
| APPL NO | 10/759928 |
| ART UNIT | 3745 — Thermal & Combustion Technology, Motive & Fluid Power Systems |
| CURRENT CPC | Rotary kinetic fluid motors or pumps 415/185 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094121 | Marks et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Northwestern University (Evanston, Illinois) |
| INVENTOR(S) | Tobin J. Marks (Evanston, Illinois); Qingwu Wang (Chicago, Illinois) |
| ABSTRACT | New organic light-emitting diodes and related electroluminescent devices and methods for fabrication, using siloxane self-assembly techniques. |
| FILED | Tuesday, July 01, 2003 |
| APPL NO | 10/610725 |
| ART UNIT | 2879 — Optics |
| CURRENT CPC | Electric lamp or space discharge component or device manufacturing 445/24 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094341 | Max |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Marine Desalination Systems, L.L.C. (Washington, District of Columbia) |
| INVENTOR(S) | Michael David Max (St. Pete Beach, Florida) |
| ABSTRACT | Processes and apparatus are disclosed for separating and purifying aqueous solutions such as seawater by causing a substantially impermeable mat of gas hydrate to form on a porous restraint. Once the mat of gas hydrate has formed on the porous restraint, the portion of the mat of gas hydrate adjacent to the restraint is caused to dissociate and flow through the restraint, e.g., by lowering the pressure in a collection region on the opposite side of the restraint. The purified or desalinated water may then be recovered from the collection region. The process may be used for marine desalination as well as for drying wet gas and hydrocarbon solutions. If conditions in the solution are not conductive to forming hydrate, a heated or refrigerated porous restraint may be used to create hydrate-forming conditions near the restraint, thereby causing gas hydrates to form directly on the surface of the restraint. |
| FILED | Friday, March 25, 2005 |
| APPL NO | 11/089369 |
| ART UNIT | 1724 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Liquid purification or separation 210/170 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094410 | Reisfeld et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Scripps Research Institute (LaJolla, California) |
| INVENTOR(S) | Ralph A. Reisfeld (La Jolla, California); Andreas G. Niethammer (San Diego, California); Rong Xiang (San Diego, California) |
| ABSTRACT | A DNA vaccine effective for inhibiting endothelial cell proliferation comprises a DNA construct operably encoding a vascular endothelial growth factor (VEGF) receptor protein. This invention provides DNA vaccines that encode VEGF receptor-2 (KDR, SEQ ID NO: 2), VEGF receptor-1 (Flt-1, (SEQ ID NO: 4), or Flk-1 (the murine homolog of KDR, SEQ ID NO: 6), DNA sequences SEQ ID NOS: 1, 3, and 5 respectively, as well as methods of using such a DNA vaccine to inhibit vascular endothelial cell proliferation in the tumor micro-environment. Anti-angiogenesis and subsequent decrease in tumor growth and dissemination is achieved. |
| FILED | Saturday, March 02, 2002 |
| APPL NO | 10/090183 |
| ART UNIT | 1633 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/200.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094417 | Shedd et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Army (Washington, District of Columbia) |
| INVENTOR(S) | Tommy R. Shedd (Middletown, Maryland); Mark W. Widder (Chambersburg, Pennsylvania); Eugene Hull (New York, New York) |
| ABSTRACT | The invention is a method and kit for conducting a rapid toxicity test. Methods and kits according to the invention include an animal or plant species in diapause. |
| FILED | Thursday, June 05, 2003 |
| APPL NO | 10/454821 |
| ART UNIT | 1615 — Organic Compounds: Bio-affecting, Body Treating, Drug Delivery, Steroids, Herbicides, Pesticides, Cosmetics, and Drugs |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/405 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094571 | Harvey et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Board of Regents of The University of Texas System (Austin, Texas) |
| INVENTOR(S) | Barrett R. Harvey (Austin, Texas); George Georgiou (Austin, Texas); Brent L. Iverson (Austin, Texas) |
| ABSTRACT | The invention overcomes the deficiencies of the prior art by providing a rapid approach for isolating binding proteins capable of binding small molecules and peptides. In the technique, libraries of candidate binding proteins, such as antibody sequences, are expressed in the periplasm of gram negative bacteria and mixed with a labeled ligand. In clones expressing recombinant polypeptides with affinity for the ligand, the concentration of the labeled ligand bound to the binding protein is increased and allows the cells to be isolated from the rest of the library. Where fluorescent labeling of the target ligand is used, cells may be isolated by fluorescence activated cell sorting (FACS). The approach is more rapid than prior art methods and avoids problems associated with the outer surface-expression of ligand fusion proteins employed with phage display. |
| FILED | Tuesday, July 15, 2003 |
| APPL NO | 10/620278 |
| ART UNIT | 1645 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/69.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094622 | Cui et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Louisiana Tech University Foundation, Inc. (Ruston, Louisiana) |
| INVENTOR(S) | Tianhong Cui (Ruston, Louisiana); Jing Wang (Ruston, Louisiana); Yongjun Zhao (Ruston, Louisiana) |
| ABSTRACT | A process for fabricating a polymer based circuit by the following steps. A mold of a design is formed through a lithography process. The design is transferred to a polymer substrate through a hot embossing process. A metal layer is then deposited over at least part of said design and at least one electrical lead is connected to said metal layer. |
| FILED | Wednesday, August 27, 2003 |
| APPL NO | 10/648927 |
| ART UNIT | 2822 — Semiconductors/Memory |
| CURRENT CPC | Semiconductor device manufacturing: Process 438/57 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094875 | Punnonen et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Maxygen, Inc. (Redwood City, California) |
| INVENTOR(S) | Juha Punnonen (Belmont, California); Alexandra L. L. Lazetic (San Jose, California); Steven R. Leong (Berkeley, California); Chia-Chun Chang (Los Gatos, California) |
| ABSTRACT | The invention provides polynucleotides and polypeptides encoded therefrom having advantageous properties, including an ability of the polypeptides to preferentially bind a CD28 or CTLA-4 receptor at a level greater or less than the ability of human B7-1 to bind CD28 or CTLA-4, or to induce or inhibit altered level of T cell proliferation response greater compared to that generated by human B7-1. The polypeptides and polynucleotides of the invention are useful in therapeutic and prophylactic treatment methods, gene therapy applications, and vaccines. |
| FILED | Friday, June 22, 2001 |
| APPL NO | 09/888324 |
| ART UNIT | 1644 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/350 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094883 | Cassels et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Army (Washington, District of Columbia) |
| INVENTOR(S) | Frederick Cassels (Ellicott City, Maryland); Andrew Lees (Silver Spring, Maryland); Richard Schuman (North Potomac, Maryland) |
| ABSTRACT | A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO. 2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom. |
| FILED | Friday, August 01, 1997 |
| APPL NO | 08/905046 |
| ART UNIT | 1645 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/388.400 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095062 | Linthicum et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | North Carolina State University (Raleigh, North Carolina) |
| INVENTOR(S) | Kevin J. Linthicum (Angier, North Carolina); Thomas Gehrke (Carrboro, North Carolina); Robert F. Davis (Raleigh, North Carolina) |
| ABSTRACT | A substrate includes non-gallium nitride posts that define trenches therebetween, wherein the non-gallium nitride posts include non-gallium nitride sidewalls and non-gallium nitride tops and the trenches include non-gallium floors. Gallium nitride is grown on the non-gallium nitride posts, including on the non-gallium nitride tops. Preferably, gallium nitride pyramids are grown on the non-gallium nitride tops and gallium nitride then is grown on the gallium nitride pyramids. The gallium nitride pyramids preferably are grown at a first temperature and the gallium nitride preferably is grown on the pyramids at a second temperature that is higher than the first temperature. The first temperature preferably is about 1000° C. or less and the second temperature preferably is about 1100° C. or more. However, other than temperature, the same processing conditions preferably are used for both growth steps. The grown gallium nitride on the pyramids preferably coalesces to form a continuous gallium nitride layer. Accordingly, gallium nitride may be grown without the need to form masks during the gallium nitride growth process. Moreover, the gallium nitride growth may be performed using the same processing conditions other than temperatures changes. Accordingly, uninterrupted gallium nitride growth may be performed. |
| FILED | Tuesday, March 08, 2005 |
| APPL NO | 11/074485 |
| ART UNIT | 2812 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/103 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095285 | Heston et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Raytheon Company (Waltham, Massachusetts) |
| INVENTOR(S) | David D. Heston (Dallas, Texas); John G. Heston (Murphy, Texas); Brian P. Helm (Sachse, Texas); Gordon R. Scott (Plano, Texas); Scott Mitchel Heston (Dallas, Texas); David R. Fletcher (Allen, Texas); William S. Kopp (Greensboro, North Carolina) |
| ABSTRACT | According to one embodiment of the present invention a method for biasing a power amplifier having at least one transistor exhibiting kink anomaly includes providing a bias circuit coupled to a gate of at least one transistor of the power amplifier. The method also includes providing, by the bias circuit, a bias voltage to the gate. The bias circuit has a load characteristic that intersects a current versus gate voltage curve for the gate at a frequency of operation of the power amplifier only once and that exhibits a low impedance at the intersection of the load characteristic with the current versus gate curve of the gate. |
| FILED | Monday, July 26, 2004 |
| APPL NO | 10/901416 |
| ART UNIT | 2817 — Semiconductors/Memory |
| CURRENT CPC | Amplifiers 330/296 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095355 | Graham et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Raytheon Company (Waltham, Massachusetts) |
| INVENTOR(S) | Roger W. Graham (Santa Barbara, California); John T. Caulfield (Santa Barbara, California) |
| ABSTRACT | An analog to digital converter ADC is adapted for low power for use in an imaging array. The ADC is a digital inverter with feedback to convert an asynchronous ramp voltage to an output count at each crossing of a voltage threshold. A separate circuit generates a voltage ramp that is coupled through a capacitor to a photocurrent from a detector, generating an integrating voltage that is raised at a source follower circuit. The integrating voltage from the source follower circuit is converted to another voltage ramp and inverted at the ADC. A global count from an array of such ADCs is stored in a grey counter. The ADC is sufficiently power-efficient that each unit cell of an array of photo detectors can have its own ADC. Circuit and device-level embodiments are disclosed. |
| FILED | Monday, May 09, 2005 |
| APPL NO | 11/125509 |
| ART UNIT | 2819 — Semiconductors/Memory |
| CURRENT CPC | Coded data generation or conversion 341/169 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095484 | Fries |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of South Florida (Tampa, Florida) |
| INVENTOR(S) | David P. Fries (St. Petersburg, Florida) |
| ABSTRACT | A method and apparatus to create two dimensional and three dimensional structures using a maskless photolithography system that is semi-automated, directly reconfigurable, and does not require masks, templates or stencils to create each of the planes or layers on a multi layer two-dimensional or three dimensional structure. In an embodiment, the pattern generator comprises a micromirror array wherein the positioning of the mirrors in the micromirror array and the time duration of exposure can be modulated to produce gray scale patterns to photoform layers of continuously variable thickness. The desired pattern can be designed and stored using conventional computer aided drawing techniques and can be used to control the positioning of the individual mirrors in the micromirror array to reflect the corresponding desired pattern. A fixture for mounting of the substrate can be incorporated and can allow the substrate to be moved three dimensions. The fixture can be rotated in one, two, or three directions. |
| FILED | Monday, April 07, 2003 |
| APPL NO | 10/408696 |
| ART UNIT | 2851 — Printing/Measuring and Testing |
| CURRENT CPC | Photocopying 355/67 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095493 | Harres |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Boeing Company (Chicago, Illinois) |
| INVENTOR(S) | Daniel N. Harres (Belleville, Illinois) |
| ABSTRACT | An inexpensive optical time domain reflectometer is disclosed that comprises a variable delay device and that is capable of identifying the location of a damage portion of a fiber optic cable with great accuracy and minimal power consumption. A method of providing a vehicle with an on-board optical time domain reflectometer is also disclosed. |
| FILED | Monday, November 24, 2003 |
| APPL NO | 10/722688 |
| ART UNIT | 2877 — Optics |
| CURRENT CPC | Optics: Measuring and testing 356/73.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095540 | Javidi et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The University of Connecticut (Farmington, Connecticut) |
| INVENTOR(S) | Bahram Javidi (Storrs, Connecticut); Ahouzi Esmail (Rabat, Morocco); Guanshen (Eric) Zhang (Reston, Virginia) |
| ABSTRACT | A method of verifying the authenticity of an object is presented. The method comprises providing a primary image; providing a secondary image; encoding the primary image; providing a random code; convolving the encoded primary image with the random code, providing thereby a reference image; affixing the reference image to the object to be authenticated; transforming the reference image; and comparing the transformed reference image with the secondary image. A system for verifying the authenticity of an object is presented. The system comprises a signal source; a first subsystem receiving a first signal from the signal source and providing as output therefrom a first output signal; a second subsystem receiving a second signal from the signal source and providing as output therefrom a second output signal; a third subsystem receiving the first and second output signals for comparing the first output signal with the second output signal. |
| FILED | Friday, January 28, 2000 |
| APPL NO | 09/493692 |
| ART UNIT | 2872 — Optics |
| CURRENT CPC | Optical: Systems and elements 359/29 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095542 | Yu et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Paul K. Yu (San Diego, California); Dong-Soo Shin (Petaluma, California) |
| ABSTRACT | An electroabsorption modulator (10) includes at least one quantum well (26) in a conduction band and a corresponding quantum well (26) in a valence band. A barrier made from InGaAlAs or InGaAsP is formed within each of the quantum wells in the conduction and valence bands. |
| FILED | Friday, February 01, 2002 |
| APPL NO | 10/470783 |
| ART UNIT | 2873 — Optics |
| CURRENT CPC | Optical: Systems and elements 359/248 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095555 | Clarke et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Army (Washington, District of Columbia) |
| INVENTOR(S) | Frederick W. Clarke (Madison, Alabama); Saulius Balevicius (Vilnius, Lithuania) |
| ABSTRACT | An apparatus for and a method of amplifying Faraday or Voigt rotation by passing light through a sample many times using multiple internal reflections and successive mirrored chambers that repeatedly send the light back through the sample. The sample is placed in a sample chamber that is adjacent to an optical amplifier chamber, and the optical amplifier chamber is adjacent to one or more additional chambers. The sample has a magnetic field applied thereto. The sample chamber receives light from a light source. The light reflects within the sample chamber and the sample to accumulate rotation of the light. The sample chamber transmits the light to the optical amplifier chamber. The optical amplifier chamber transmits the light to the additional chambers and reflects the light back to the sample where the light undergoes further rotation. Each one of the additional chambers transmits the light to the next additional chamber and reflects the light back to a previous chamber. |
| FILED | Thursday, August 25, 2005 |
| APPL NO | 11/215201 |
| ART UNIT | 3663 — Computerized Vehicle Controls and Navigation, Radio Wave, Optical and Acoustic Wave Communication, Robotics, and Nuclear Systems |
| CURRENT CPC | Optical: Systems and elements 359/347 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095646 | Slaughter et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Freescale Semiconductor, Inc. (Austin, Texas) |
| INVENTOR(S) | Jon M. Slaughter (Tempe, Arizona); Anatoli A. Korkin, legal representative (Gilbert, Arizona); Herbert Goronkin (Tempe, Arizona) |
| ABSTRACT | A multi-state magnetoresistive random access memory device having a pinned ferromagnetic region with a magnetic moment vector fixed in a preferred direction in the absence of an applied magnetic field, an non-ferromagnetic spacer layer positioned on the pinned ferromagnetic region, and a free ferromagnetic region with an anisotropy designed to provide a free magnetic moment vector within the free ferromagnetic region with N stable positions, wherein N is a whole number greater than two, positioned on the non-ferromagnetic spacer layer. The number N of stable positions can he induced by a shape anisotropy of the free ferromagnetic region wherein each N stable position has a unique resistance value. |
| FILED | Wednesday, July 17, 2002 |
| APPL NO | 10/198203 |
| ART UNIT | 2824 — Semiconductors/Memory |
| CURRENT CPC | Static information storage and retrieval 365/158 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095772 | Delfyett et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Research Foundation of the University of Central Florida, Inc. (Orlando, Florida) |
| INVENTOR(S) | Peter J. Delfyett (Geneva, Florida); Kyungbum Kim (Orlando, Florida); Bojan Resan (Orlando, Florida) |
| ABSTRACT | Methods, devices and systems for generating ultrashort optical linear chirped pulses with very high power by amplifying the pulses so that their temporal duration is longer than the storage time of the amplifying medium. The additional gain factor is related to the ratio of the storage time to the stretched pulse. A preferred embodiment connects a mode locked laser source that generates optical pulses whose duration is stretched with a chirped fiber Bragg grating. Embodiments include methods, devices and systems causing an extreme chirped pulse amplifier (XCPA) effect in an oscillator. |
| FILED | Wednesday, April 21, 2004 |
| APPL NO | 10/828965 |
| ART UNIT | 2828 — Semiconductors/Memory |
| CURRENT CPC | Coherent light generators 372/50.220 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095910 | Blake et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Honeywell International, Inc. (Morristown, New Jersey) |
| INVENTOR(S) | James Blake (Paradise Valley, Arizona); Charles Lange (Glendale, Arizona) |
| ABSTRACT | An exemplary WDM coupling device may include optical fibers. The coupling device may also include region(s) having varying coefficients of thermal expansion. During a temperature variation, one or more of the region(s) may alter in size to substantially cancel temperature-dependent changes associated with the WDM coupling device. |
| FILED | Friday, January 31, 2003 |
| APPL NO | 10/355464 |
| ART UNIT | 2883 — Optics |
| CURRENT CPC | Optical waveguides 385/5 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07096125 | Padmanabhan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Honeywell International Inc. (Morristown, New Jersey) |
| INVENTOR(S) | Aravind Padmanabhan (Plymouth, Minnesota); Subash Krishnankutty (North Haven, Connecticut); Wing Au (Bloomington, Minnesota); Mike Bazakos (Bloomington, Minnesota); Brian Krafthefer (Stillwater, Minnesota) |
| ABSTRACT | A sensor network provides the ability to detect, classify and identify a diverse range of agents over a large area, such as a geographical region or building. The network possesses speed of detection, sensitivity, and specificity for the diverse range of agents. Different functional level types of sensors are employed in the network to perform early warning, broadband detection and highly specific and sensitive detection. A high probability of detection with low probability of false alarm is provided by the processing of information provided from multiple sensors. A Bayesian net is utilized to combine probabilities from the multiple sensors in the network to reach a decision regarding the presence or absence of a threat. The network is field portable and capable of autonomous operation. It also is capable of providing automated output decisions. |
| FILED | Monday, December 17, 2001 |
| APPL NO | 10/024462 |
| ART UNIT | 2863 — Printing/Measuring and Testing |
| CURRENT CPC | Data processing: Measuring, calibrating, or testing 72/24 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07096184 | Ahroon |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Army (Washington, District of Columbia) |
| INVENTOR(S) | William A. Ahroon (Enterprise, Alabama) |
| ABSTRACT | In one embodiment, a method is characterized by accepting voice input defining at least one spoken word; and calibrating the at least one spoken word in response to at least one defined speech-energy criterion. In one embodiment, a related system includes but is not limited to circuitry and/or programming for effecting the foregoing-referenced method embodiment; the circuitry and/or programming can be virtually any combination of hardware, software, and/or firmware configured to effect the foregoing-referenced method embodiments depending upon the design choices of the system designer. |
| FILED | Tuesday, December 18, 2001 |
| APPL NO | 10/025725 |
| ART UNIT | 2655 — Digital Audio Data Processing |
| CURRENT CPC | Data processing: Speech signal processing, linguistics, language translation, and audio compression/decompression 74/270 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07096248 | Masters et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | Michael W. Masters (Fredericksburg, Virginia); Larry A. Fontenot (King George, Virginia); Paul V. Werme (King George, Virginia); Lonnie R. Welch (Athens, Ohio) |
| ABSTRACT | A program control device operating in a distributed environment comprised of hosts instantiating copies of a scalable application, the program control device controlling start up, shutdown or movement of a selected one of the copies based on signals generated in response to first information regarding performance of all copies of the scalable application and second infomation regarding performance of the hosts. |
| FILED | Wednesday, September 19, 2001 |
| APPL NO | 09/864821 |
| ART UNIT | 2157 — Data Bases & File Management |
| CURRENT CPC | Electrical computers and digital processing systems: Multicomputer data transferring 79/201 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07096264 | Bonney et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Architecture Technology Corp. (Eden Prairie, Minnesota) |
| INVENTOR(S) | Jordan C. Bonney (Bloomington, Minnesota); Benjamin L. Burnett (Prior Lake, Minnesota); Deborah K. Charan (Minneapolis, Minnesota) |
| ABSTRACT | A system is described for monitoring and testing computer networks, such as enterprise networks that tend to have a number of geographically dispersed devices and interconnected sub-networks. The system includes a plurality of distributed agents coupled to a computing network. The system further includes a replay module coupled to the network that has a storage medium to store replay data. The replay module communicates respective portions of the replay data to the agents, and issues commands to the agents to control introduction of the network packets on the computing network by the agents. In this way, the system recreates network activity in order to test the computer network. The replay data stored by the storage medium may define a conditional flow for introduction of the network packets by the agents. Accordingly, the replay module may issue commands to the agents in accordance with the conditional flow. |
| FILED | Friday, January 25, 2002 |
| APPL NO | 10/057574 |
| ART UNIT | 2155 — Data Bases & File Management |
| CURRENT CPC | Electrical computers and digital processing systems: Multicomputer data transferring 79/224 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07096412 | Chen et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | TrellisWare Technologies, Inc. (San Diego, California) |
| INVENTOR(S) | Xiaopeng Chen (Sunnyvale, California); Keith M. Chugg (Burbank, California) |
| ABSTRACT | In a digital information processing system wherein a model of a finite state machine (FSM) receiving a plurality of FSM inputs and producing a plurality of FSM outputs is represented by a reduced-state trellis and wherein the FSM inputs are defined on a base closed set of symbols, a novel method is presented for updating soft decision information on the FSM inputs into higher confidence information whereby (1) the soft decision information is inputted in a first index set, (2) a forward recursion is processed on the input soft decision information based on the reduced-state trellis representation to produce forward state metrics, (3) a backward recursion is processed on the input soft decision information based on the reduced-state trellis representation to produce backward state metrics, wherein the backward recursion is independent of the forward recursion and (4) the forward state metrics and the backward state metrics are operated on to produce the higher confidence information. |
| FILED | Thursday, June 14, 2001 |
| APPL NO | 09/882283 |
| ART UNIT | 2133 — Memory Access and Control |
| CURRENT CPC | Error detection/correction and fault detection/recovery 714/794 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07096502 | Fox et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Harris Corporation (Melbourne, Florida) |
| INVENTOR(S) | Kevin L. Fox (Palm Bay, Florida); Ronda R. Henning (West Melbourne, Florida); John T. Farrell (Melbourne, Florida); Clifford C. Miller (Palm Bay, Florida) |
| ABSTRACT | A method and data processing system assesses the security vulnerability of a network by creating a system object model database representing a network. The system object model database supports the information data requirements of disparate network vulnerability analysis programs. The system object model database is exported to the disparate network vulnerability analysis programs. The network is analyzed with each network vulnerability analysis program to produce data results from each program. Data results are correlated to determine the security posture of the network. |
| FILED | Tuesday, February 08, 2000 |
| APPL NO | 09/500108 |
| ART UNIT | 2131 — Memory Access and Control |
| CURRENT CPC | Information security 726/25 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Energy (DOE)
| US 07093476 | Gross et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | UT-Battelle, LLC (Oak Ridge, Tennessee) |
| INVENTOR(S) | Ian G Gross (Clinton, Tennessee); Larry A Pierce (Kingston, Tennessee) |
| ABSTRACT | A method for reducing the cross-sectional diameter of a radioactive californium-containing cermet wire while simultaneously improving the wire diameter to a more nearly circular cross section. A collet fixture is used to reduce the wire diameter by controlled pressurization pulses while simultaneously improving the wire cross-sectional diameter. The method is especially suitable for use in hot cells for the production of optimized cermet brachytherapy sources that contain large amounts of radioactive californium-252. |
| FILED | Wednesday, September 15, 2004 |
| APPL NO | 10/941131 |
| ART UNIT | 3725 — Manufacturing Devices & Processes, Machine Tools & Hand Tools Group Art Units |
| CURRENT CPC | Metal deforming 072/402 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07093654 | Hall et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | IntelliServ, Inc. (Provo, Utah) |
| INVENTOR(S) | David R. Hall (Provo, Utah); David S. Pixton (Lehi, Utah); Scott Dahlgren (Provo, Utah); Jay T. Reynolds (West Provo, Utah); James W. Breihan (Houston, Texas); Michael A. Briscoe (Lehi, Utah) |
| ABSTRACT | The present invention includes a downhole component adapted for transmitting downhole data. The downhole component includes a threaded end on a downhole component. The threaded end furthermore includes an interior region, and exterior region, and a mating surface wherein a cavity is formed. A data transmission element is disposed in the cavity and displaces a volume of the cavity. At least one passageway is formed in the threaded region between interior and exterior regions. The passageway is in fluid communication with both the interior and exterior regions and thereby relieves pressure build up of thread lubricant upon tool joint make up. |
| FILED | Thursday, July 22, 2004 |
| APPL NO | 10/710586 |
| ART UNIT | 3672 — Wells, Earth Boring/Moving/Working, Excavating, Mining, Harvesters, Bridges, Roads, Petroleum, Closures, Connections, and Hardware |
| CURRENT CPC | Wells 166/242.600 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07093889 | Graham |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Freight Wing Inc. (Seattle, Washington) |
| INVENTOR(S) | Sean C. Graham (Seattle, Washington) |
| ABSTRACT | A device for reducing vehicle aerodynamic resistance for vehicles having a generally rectangular body disposed above rear wheels, comprising a plurality of load bearing struts attached to the bottom of the rectangular body adjacent its sides, a plurality of opposing flat sheets attached to the load bearing struts, and angled flaps attached to the lower edge of the opposing sheets defining an obtuse angle with the opposing flat sheets extending inwardly with respect to the sides of the rectangular body to a predetermined height above the ground, which, stiffen the opposing flat sheets, bend to resist damage when struck by the ground, and guide airflow around the rear wheels of the vehicle to reduce its aerodynamic resistance when moving. |
| FILED | Monday, October 04, 2004 |
| APPL NO | 10/957044 |
| ART UNIT | 3612 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Land vehicles: Bodies and tops 296/180.400 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094301 | Butt et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Air Products and Chemicals, Inc. (Allentown, Pennsylvania) |
| INVENTOR(S) | Darryl Paul Butt (Gainesville, Florida); Raymond Ashton Cutler (Bountiful, Utah); Steven Walton Rynders (Riverton, Utah); Michael Francis Carolan (Allentown, Pennsylvania) |
| ABSTRACT | A method of joining at least two sintered bodies to form a composite structure, including providing a first multicomponent metallic oxide having a perovskitic or fluorite crystal structure; providing a second sintered body including a second multicomponent metallic oxide having a crystal structure of the same type as the first; and providing at an interface a joint material containing at least one metal oxide containing at least one metal identically contained in at least one of the first and second multicomponent metallic oxides. The joint material is free of cations of Si, Ge, Sn, Pb, P and Te and has a melting point below the sintering temperatures of both sintered bodies. The joint material is heated to a temperature above the melting point of the metal oxide(s) and below the sintering temperatures of the sintered bodies to form the joint. Structures containing such joints are also disclosed. |
| FILED | Friday, March 21, 2003 |
| APPL NO | 10/393564 |
| ART UNIT | 1775 — Refrigeration, Vaporization, Ventilation, and Combustion |
| CURRENT CPC | Adhesive bonding and miscellaneous chemical manufacture 156/89.110 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094326 | Crocker et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Sandia National Laboratories (Livermore, California) |
| INVENTOR(S) | Robert W. Crocker (Fremont, California); Cindy K. Harnett (Livermore, California); Judith L. Rognlien (Livermore, California) |
| ABSTRACT | An electrode device for high pressure applications. These electrodes, designed to withstand pressure of greater than 10,000 psi, are adapted for use in microfluidic devices that employ electrokinetic or electrophoretic flow. The electrode is composed, generally, of an outer electrically insulating tubular body having a porous ceramic frit material disposed in one end of the outer body. The pores of the porous ceramic material are filled with an ion conductive polymer resin. A conductive material situated on the upper surface of the porous ceramic frit material and, thus isolated from direct contact with the electrolyte, forms a gas diffusion electrode. A metal current collector, in contact with the gas diffusion electrode, provides connection to a voltage source. |
| FILED | Tuesday, December 24, 2002 |
| APPL NO | 10/330607 |
| ART UNIT | 1753 — Refrigeration, Vaporization, Ventilation, and Combustion |
| CURRENT CPC | Chemistry: Electrical and wave energy 24/600 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094333 | Yang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Regents of the University of Michigan (Ann Arbor, Michigan) |
| INVENTOR(S) | Ralph T. Yang (Ann Arbor, Michigan); Arturo J. Hernandez-Maldonado (Ann Arbor, Michigan); Frances H. Yang (Ann Arbor, Michigan); Akira Takahashi (Yoko-Machi, Japan) |
| ABSTRACT | A method for removing thiophene and thiophene compounds from liquid fuel includes contacting the liquid fuel with an adsorbent which preferentially adsorbs the thiophene and thiophene compounds. The adsorption takes place at a selected temperature and pressure, thereby producing a non-adsorbed component and a thiophene/thiophene compound-rich adsorbed component. The adsorbent includes either a metal or a metal cation that is adapted to form π-complexation bonds with the thiophene and/or thiophene compounds, and the preferential adsorption occurs by π-complexation. A further method includes selective removal of aromatic compounds from a mixture of aromatic and aliphatic compounds. |
| FILED | Wednesday, December 03, 2003 |
| APPL NO | 10/726935 |
| ART UNIT | 1764 — Organic Chemistry, Polymers, Compositions |
| CURRENT CPC | Mineral oils: Processes and products 28/250 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094387 | Zidan |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Washington Savannah River Company LLC (Aiken, South Carolina) |
| INVENTOR(S) | Ragaiy Zidan (Aiken, South Carolina) |
| ABSTRACT | A hydrogen storage material and process of forming the material is provided in which complex hydrides are combined under conditions of elevated temperatures and/or elevated temperature and pressure with a titanium metal such as titanium butoxide. The resulting fused product exhibits hydrogen desorption kinetics having a first hydrogen release point which occurs at normal atmospheres and at a temperature between 50° C. and 90° C. |
| FILED | Monday, November 03, 2003 |
| APPL NO | 10/700001 |
| ART UNIT | 1754 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Chemistry of inorganic compounds 423/644 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094675 | Liang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Battelle Memorial Institute (Richland, Washington) |
| INVENTOR(S) | Yong Liang (Richland, Washington); John L. Daschbach (Richland, Washington); Yali Su (Richland, Washington); Scott A. Chambers (Kennewick, Washington) |
| ABSTRACT | A method for producing quantum dots. The method includes cleaning an oxide substrate and separately cleaning a metal source. The substrate is then heated and exposed to the source in an oxygen environment. This causes metal oxide quantum dots to form on the surface of the substrate. |
| FILED | Friday, January 10, 2003 |
| APPL NO | 10/340502 |
| ART UNIT | 2815 — Semiconductors/Memory |
| CURRENT CPC | Semiconductor device manufacturing: Process 438/608 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094722 | Balmer-Millar et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Caterpillar Inc. (Peoria, Illinois) |
| INVENTOR(S) | Mari Lou Balmer-Millar (Chillicothe, Illinois); Paul W. Park (Peoria, Illinois); Alexander G. Panov (Peoria, Illinois) |
| ABSTRACT | The activity and durability of a zeolite lean-bum NOx catalyst can be increased by loading metal cations on the outer surface of the zeolite. However, the metal loadings can also oxidize sulfur dioxide to cause sulfate formation in the exhaust. The present invention is a method of suppressing sulfate formation in an exhaust purification system including a NOx catalyst. The NOx catalyst includes a zeolite loaded with at least one metal. The metal is selected from among an alkali metal, an alkaline earth metal, a lanthanide metal, a noble metal, and a transition metal. In order to suppress sulfate formation, at least a portion of the loaded metal is complexed with at least one of sulfate, phosphate, and carbonate. |
| FILED | Friday, December 20, 2002 |
| APPL NO | 10/327636 |
| ART UNIT | 1754 — Semiconductors/Memory |
| CURRENT CPC | Catalyst, solid sorbent, or support therefor: Product or process of making 52/60 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094989 | McJunkin et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Battelle Energy Alliance, LLC (Idaho Falls, Idaho) |
| INVENTOR(S) | Timothy R. McJunkin (Idaho Falls, Idaho); John A. Johnson (Ashland, Oregon); Eric D. Larsen (Idaho Falls, Idaho); Herschel B. Smartt (Idaho Falls, Idaho) |
| ABSTRACT | A welding apparatus using ultrasonic sensing is described and which includes a movable welder having a selectively adjustable welding head for forming a partially completed weld in a weld seam defined between adjoining metal substrates; an ultrasonic assembly borne by the moveable welder and which is operable to generate an ultrasonic signal which is directed toward the partially completed weld, and is further reflected from same; and a controller electrically coupled with the ultrasonic assembly and controllably coupled with the welding head, and wherein the controller receives information regarding the ultrasonic signal and in response to the information optimally positions the welding head relative to the weld seam. |
| FILED | Monday, April 12, 2004 |
| APPL NO | 10/828560 |
| ART UNIT | 1725 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Electric heating 219/124.340 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095020 | Hough et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Brookhaven Science Associates (Upton, New York) |
| INVENTOR(S) | Paul V. C. Hough (Port Jefferson, New York); Chengpu Wang (Upton, New York) |
| ABSTRACT | An atomic force microscope is described having a cantilever comprising a base and a probe tip on an end opposite the base; a cantilever drive device connected to the base; a magnetic material coupled to the probe tip, such that when an incrementally increasing magnetic field is applied to the magnetic material an incrementally increasing force will be applied to the probe tip; a moveable specimen base; and a controller constructed to obtain a profile height of a specimen at a point based upon a contact between the probe tip and a specimen, and measure an adhesion force between the probe tip and the specimen by, under control of a program, incrementally increasing an amount of a magnetic field until a release force, sufficient to break the contact, is applied. An imaging method for atomic force microscopy involving measuring a specimen profile height and adhesion force at multiple points within an area and concurrently displaying the profile and adhesion force for each of the points is also described. A microscope controller is also described and is constructed to, for a group of points, calculate a specimen height at a point based upon a cantilever deflection, a cantilever base position and a specimen piezo position; calculate an adhesion force between a probe tip and a specimen at the point by causing an incrementally increasing force to be applied to the probe tip until the probe tip separates from a specimen; and move the probe tip to a new point in the group. |
| FILED | Friday, September 03, 2004 |
| APPL NO | 10/933591 |
| ART UNIT | 2881 — Optics |
| CURRENT CPC | Radiant energy 250/306 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095050 | Wanlass et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Midwest Research Institute (Kansas City, Missouri) |
| INVENTOR(S) | Mark W. Wanlass (Golden, Colorado); Angelo Mascarenhas (Lakewood, Colorado) |
| ABSTRACT | Monolithic, tandem, photonic cells include at least a first semiconductor layer and a second semiconductor layer, wherein each semiconductor layer includes an n-type region, a p-type region, and a given band-gap energy. Formed within each semiconductor layer is a sting of electrically connected photonic sub-cells. By carefully selecting the numbers of photonic sub-cells in the first and second layer photonic sub-cell string(s), and by carefully selecting the manner in which the sub-cells in a first and second layer photonic sub-cell string(s) are electrically connected, each of the first and second layer sub-cell strings may be made to achieve one or more substantially identical electrical characteristics. |
| FILED | Thursday, February 28, 2002 |
| APPL NO | 10/275123 |
| ART UNIT | 2826 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/79 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095129 | Moroz |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | General Electric Company (Schenectady, New York) |
| INVENTOR(S) | Emilian Mieczyslaw Moroz (San Diego, California) |
| ABSTRACT | A wind turbine having a rotor, at least one rotor blade, and a plurality of generators, of which a first generator is configured to provide power to an electric grid and a second generator is configured to provide power to the wind turbine during times of grid loss. The wind turbine is configured to utilize power provided by the second generator to reduce loads on the wind turbine during times of grid loss. |
| FILED | Wednesday, June 30, 2004 |
| APPL NO | 10/880715 |
| ART UNIT | 2834 — Electrical Circuits and Systems |
| CURRENT CPC | Prime-mover dynamo plants 290/44 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095153 | Shoykhet |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Reliance Electric Technologies, LLC (Mayfield Heights, Ohio) |
| INVENTOR(S) | Boris A. Shoykhet (Beachwood, Ohio) |
| ABSTRACT | An extended stator core in a motor/generator can be utilized to mitigate losses in end regions of the core and a frame of the motor/generator. To mitigate the losses, the stator core can be extended to a length substantially equivalent to or greater than a length of a magnetically active portion in the rotor. Alternatively, a conventional length stator core can be utilized with a shortened magnetically active portion to mitigate losses in the motor/generator. To mitigate the losses in the core caused by stator winding, the core can be extended to a length substantially equivalent or greater than a length of stator winding. |
| FILED | Monday, March 21, 2005 |
| APPL NO | 11/084889 |
| ART UNIT | 2834 — Electrical Circuits and Systems |
| CURRENT CPC | Electrical generator or motor structure 310/260 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095295 | Stalford et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Sandia Corporation (Albuquerque, New Mexico) |
| INVENTOR(S) | Harold L. Stalford (Norman, Oklahoma); Michael A. Butler (Andover, Massachusetts); W. Kent Schubert (Albuquerque, New Mexico) |
| ABSTRACT | A method for tuning a vibratory device including a cantilevered resonator comprising the steps of increasing a voltage V0 supplied to the vibratory device to thereby increase the bandwidth of the vibratory device; and keeping the resonant frequency of the vibratory device at substantially that natural frequency of the cantilevered resonator, wherein the vibratory device comprises: a capacitor including a movable plate and a fixed plate spaced from each other, the movable plate being part of the cantilevered resonator; a voltage source connected to the capacitor for providing voltage V0 across the capacitor to produce an attractive force between movable plate and fixed plate; a circuit connecting the voltage source to the capacitor; and a load resistor in said circuit having a resistance RL satisfying the following equation: where: μ is at least 10; ω0 is the beam constant for the cantilevered resonator; c0 is the capacitance for the capacitor; and λ is the voltage dependent coupling parameter for voltage V0. |
| FILED | Wednesday, May 21, 2003 |
| APPL NO | 10/443951 |
| ART UNIT | 2819 — Semiconductors/Memory |
| CURRENT CPC | Wave transmission lines and networks 333/186 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095311 | Coates et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Regents of the University of California (Los Alamos, New Mexico) |
| INVENTOR(S) | Don M. Coates (Santa Fe, New Mexico); Scott D. Briles (Los Alamos, New Mexico); Daniel L. Neagley (Albuquerque, New Mexico); David Platts (Santa Fe, New Mexico); David D. Clark (Santa Fe, New Mexico) |
| ABSTRACT | An identifying coding apparatus employing modulated reflectance technology involving a base station emitting a RF signal, with a tag, located remotely from the base station, and containing at least one antenna and predetermined other passive circuit components, receiving the RF signal and reflecting back to the base station a modulated signal indicative of characteristics related to the tag. |
| FILED | Tuesday, November 25, 2003 |
| APPL NO | 10/723073 |
| ART UNIT | 2635 — Semiconductors/Memory |
| CURRENT CPC | Communications: Electrical 340/10.410 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095612 | Beihoff et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Rockwell Automation Technologies, Inc. (Mayfield Heights, Ohio) |
| INVENTOR(S) | Bruce C. Beihoff (Wauwatosa, Wisconsin); Lawrence D. Radosevich (Muskego, Wisconsin); Mark G. Phillips (Brookfield, Wisconsin); Dennis L. Kehl (Milwaukee, Wisconsin); Steven C. Kaishian (Milwaukee, Wisconsin); Daniel G. Kannenberg (Waukesha, Wisconsin) |
| ABSTRACT | A terminal structure provides interfacing with power electronics circuitry and external circuitry. The thermal support may receive one or more power electronic circuits. The support may aid in removing heat from the terminal structure and the circuits through fluid circulating through the support. The support may form a shield from both external EMI/RFI and from interference generated by operation of the power electronic circuits. Features may be provided to permit and enhance connection of the circuitry to external circuitry, such as improved terminal configurations. Modular units may be assembled that may be coupled to electronic circuitry via plug-in arrangements or through interface with a backplane or similar mounting and interconnecting structures. |
| FILED | Wednesday, August 25, 2004 |
| APPL NO | 10/926124 |
| ART UNIT | 2835 — Electrical Circuits and Systems |
| CURRENT CPC | Electricity: Electrical systems and devices 361/696 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07096123 | McAdams et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the United States Department of Energy (Washington, District of Columbia) |
| INVENTOR(S) | Hiramie T. McAdams (Carrollton, Illinois); Robert W. Crawford (Tucson, Arizona); Gerald R. Hadder (Oak Ridge, Tennessee); Barry D. McNutt (Arlington, Virginia) |
| ABSTRACT | A method for mathematically identifying at least one diesel fuel suitable for combustion in an automotive diesel engine with significantly reduced emissions and producible from known petroleum blendstocks using known refining processes, including the use of cetane additives (ignition improvers) and oxygenated compounds. |
| FILED | Monday, May 12, 2003 |
| APPL NO | 10/435537 |
| ART UNIT | 2857 — Printing/Measuring and Testing |
| CURRENT CPC | Data processing: Measuring, calibrating, or testing 72/22 |
| VIEW PATENT | @ USPTO: Full Text PDF |
National Aeronautics and Space Administration (NASA)
| US 07093486 | Challoner et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Boeing Company (Chicago, Illinois); California Institute of Technology (Pasadena, California) |
| INVENTOR(S) | A. Dorian Challoner (Manhattan Beach, California); Kirill V. Shcheglov (Los Angeles, California) |
| ABSTRACT | The present invention discloses a resonator gyroscope comprising a vibrationally isolated resonator including a proof mass, a counterbalancing plate having an extensive planar region, and one or more flexures interconnecting the proof mass and counterbalancing plate. A baseplate is affixed to the resonator by the one or more flexures and sense and drive electrodes are affixed to the baseplate proximate to the extensive planar region of the counterbalancing plate for exciting the resonator and sensing movement of the gyroscope. The isolated resonator transfers substantially no net momentum to the baseplate when the resonator is excited. |
| FILED | Friday, February 04, 2005 |
| APPL NO | 11/051884 |
| ART UNIT | 2856 — Printing/Measuring and Testing |
| CURRENT CPC | Measuring and testing 073/504.120 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094045 | Morrison |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Administrator of the National Aeronautics and Space Administration (Washington, District of Columbia) |
| INVENTOR(S) | Dennis R. Morrison (Kemah, Texas) |
| ABSTRACT | A microencapsulation apparatus is provided which is configured to form co-axial multi-lamellar microcapsules from materials discharged from first and second microsphere dispensers of the apparatus. A method of fabricating and processing microcapsules is also provided which includes forming distinct droplets comprising one or more materials and introducing the droplets directly into a solution bath to form a membrane around the droplets such that a plurality of microcapsules are formed. A microencapsulation system is provided which includes a microcapsule production unit, a fluidized passage for washing and harvesting microcapsules dispensed from the microcapsule production unit and a flow sensor for sizing and counting the microcapsules. In some embodiments, the microencapsulation system may further include a controller configured to simultaneously operate the microcapsule production unit, fluidized passage and flow sensor to process the microcapsules in a continuous manner. |
| FILED | Tuesday, December 09, 2003 |
| APPL NO | 10/734754 |
| ART UNIT | 1722 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Plastic article or earthenware shaping or treating: Apparatus 425/6 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094499 | Hung |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Administrator of the National Aeronautics and Space Administration (Washington, District of Columbia) |
| INVENTOR(S) | Ching-Cheh Hung (Westlake, Ohio) |
| ABSTRACT | A method of forming a composite material for use as an anode for a lithium-ion battery is disclosed. The steps include selecting a carbon material as a constituent part of the composite, chemically treating the selected carbon material to receive nanoparticles, incorporating nanoparticles into the chemically treated carbon material and removing surface nanoparticles from an outside surface of the carbon material with incorporated nanoparticles. A material making up the nanoparticles alloys with lithium. |
| FILED | Tuesday, June 10, 2003 |
| APPL NO | 10/457433 |
| ART UNIT | 1745 — Tires, Adhesive Bonding, Glass/Paper making, Plastics Shaping & Molding |
| CURRENT CPC | Chemistry: Electrical current producing apparatus, product, and process 429/231.800 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094532 | Robertson et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Vanderbilt University (Nashville, Tennessee) |
| INVENTOR(S) | David Robertson (Nashville, Tennessee); Randy D. Blakely (Brentwood, Tennessee) |
| ABSTRACT | Isolated polynucleotide molecules and peptides encoded by these molecules are used in the analysis of human norepinephrine (NE) transporter variants, as well as in diagnostic and therapeutic applications, relating to a human NE transporter polymorphism. By analyzing genomic DNA or amplified genomic DNA, or amplified cDNA derived from mRNA, it is possible to type a human NE transporter with regard to the human NE transporter polymorphism, for example, in the context of diagnosing and treating NE transport impairments, and disorders associated with NE transport impairments, such as orthostatic intolerance. |
| FILED | Thursday, December 28, 2000 |
| APPL NO | 09/750609 |
| ART UNIT | 1637 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/6 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094622 | Cui et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Louisiana Tech University Foundation, Inc. (Ruston, Louisiana) |
| INVENTOR(S) | Tianhong Cui (Ruston, Louisiana); Jing Wang (Ruston, Louisiana); Yongjun Zhao (Ruston, Louisiana) |
| ABSTRACT | A process for fabricating a polymer based circuit by the following steps. A mold of a design is formed through a lithography process. The design is transferred to a polymer substrate through a hot embossing process. A metal layer is then deposited over at least part of said design and at least one electrical lead is connected to said metal layer. |
| FILED | Wednesday, August 27, 2003 |
| APPL NO | 10/648927 |
| ART UNIT | 2822 — Semiconductors/Memory |
| CURRENT CPC | Semiconductor device manufacturing: Process 438/57 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094679 | Li et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Administrator of the National Aeronautics and Space Administration (Washington, District of Columbia) |
| INVENTOR(S) | Jun Li (Sunnyvale, California); Meyya Meyyappan (San Jose, California) |
| ABSTRACT | Method and system for fabricating an electrical interconnect capable of supporting very high current densities (106–1010 Amps/cm2), using an array of one or more carbon nanotubes (CNTs). The CNT array is grown in a selected spaced apart pattern, preferably with multi-wall CNTs, and a selected insulating material, such as SiOw or SiuNv, is deposited using CVD to encapsulate each CNT in the array. An exposed surface of the insulating material is planarized to provide one or more exposed electrical contacts for one or more CNTs. |
| FILED | Tuesday, March 11, 2003 |
| APPL NO | 10/390254 |
| ART UNIT | 2823 — Semiconductors/Memory |
| CURRENT CPC | Semiconductor device manufacturing: Process 438/618 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095000 | Sims, III et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Administrator of the National Aeronautics and Space Administration (Washington, District of Columbia) |
| INVENTOR(S) | William Herbert Sims, III (New Market, Alabama); Thomas J. Godfroy (Ann Arbor, Michigan); Leo Bitteker (Los Alamos, New Mexico) |
| ABSTRACT | Apparatus and methods are provided through which a radio-frequency dielectric heater has a cylindrical form factor, a variable thermal energy deposition through variations in geometry and composition of a dielectric, and/or has a thermally isolated power input. |
| FILED | Monday, September 13, 2004 |
| APPL NO | 10/943827 |
| ART UNIT | 3742 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Electric heating 219/780 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095379 | Pryor et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | ATK Alliant Techsystems, Inc. (Salt Lake City, Utah) |
| INVENTOR(S) | Mark K. Pryor (San Diego, California); John E. Marks (Escondido, California); Patrick N. Bonebright (San Diego, California); Kenneth Neal Segal (Ellicott City, Maryland); Alan Kogut (Bowie, Maryland) |
| ABSTRACT | An electrical component and a method of constructing it are disclosed. The component includes a hollow tubular structure. The structure includes a series of axially spaced apart rings and at least one outer perimeter housing member. The housing member interconnects the rings for defining an internal configuration of the hollow tubular structure for electrical purposes. The rings and the housing member each include inter-engageable elements for helping secure mechanically the rings and housing member together to facilitate final assembly of the electrical component. |
| FILED | Thursday, June 06, 2002 |
| APPL NO | 10/164990 |
| ART UNIT | 2821 — Semiconductors/Memory |
| CURRENT CPC | Communications: Radio wave antennas 343/786 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095504 | Ames et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Lockheed Martin Corporation (Bethesda, Maryland) |
| INVENTOR(S) | Lawrence L. Ames (San Jose, California); Kalyan Dutta (Los Altos Hills, California) |
| ABSTRACT | An interferometry apparatus comprises one or more beam generators, a detector, and a plurality of optical paths along which one or more beams of light propagate. Disposed along at least one of the optical paths is an apodization mask to shape one of the beams. |
| FILED | Wednesday, February 25, 2004 |
| APPL NO | 10/788166 |
| ART UNIT | 2877 — Optics |
| CURRENT CPC | Optics: Measuring and testing 356/498 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07096285 | Ellerbrock et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Boeing Company (Seattle, Washington) |
| INVENTOR(S) | Philip J. Ellerbrock (Bridgeton, Missouri); Robert L. Grant (St. Peters, Missouri); Daniel W. Konz (Hazelwood, Missouri); Joseph P. Winkelmann (St. Peters, Missouri) |
| ABSTRACT | The present invention provides a network device interface and method for digitally connecting a plurality of data channels, such as sensors, actuators, and subsystems, to a controller using a network bus. The network device interface interprets commands and data received from the controller and polls the data channels in accordance with these commands. Specifically, the network device interface receives digital commands and data from the controller, and based on these commands and data, communicates with the data channels to either retrieve data in the case of a sensor or send data to activate an actuator. Data retrieved from the sensor is then converted by the network device interface into digital signals and transmitted back to the controller. In one advantageous embodiment, the network device interface is a state machine, such as an ASIC, that operates independent of a processor in communicating with the bus controller and data channels. |
| FILED | Thursday, December 04, 2003 |
| APPL NO | 10/727414 |
| ART UNIT | 2111 — Computer Error Control, Reliability, & Control Systems |
| CURRENT CPC | Electrical computers and digital data processing systems: Input/output 710/69 |
| VIEW PATENT | @ USPTO: Full Text PDF |
National Science Foundation (NSF)
| US 07094121 | Marks et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Northwestern University (Evanston, Illinois) |
| INVENTOR(S) | Tobin J. Marks (Evanston, Illinois); Qingwu Wang (Chicago, Illinois) |
| ABSTRACT | New organic light-emitting diodes and related electroluminescent devices and methods for fabrication, using siloxane self-assembly techniques. |
| FILED | Tuesday, July 01, 2003 |
| APPL NO | 10/610725 |
| ART UNIT | 2879 — Optics |
| CURRENT CPC | Electric lamp or space discharge component or device manufacturing 445/24 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094333 | Yang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Regents of the University of Michigan (Ann Arbor, Michigan) |
| INVENTOR(S) | Ralph T. Yang (Ann Arbor, Michigan); Arturo J. Hernandez-Maldonado (Ann Arbor, Michigan); Frances H. Yang (Ann Arbor, Michigan); Akira Takahashi (Yoko-Machi, Japan) |
| ABSTRACT | A method for removing thiophene and thiophene compounds from liquid fuel includes contacting the liquid fuel with an adsorbent which preferentially adsorbs the thiophene and thiophene compounds. The adsorption takes place at a selected temperature and pressure, thereby producing a non-adsorbed component and a thiophene/thiophene compound-rich adsorbed component. The adsorbent includes either a metal or a metal cation that is adapted to form π-complexation bonds with the thiophene and/or thiophene compounds, and the preferential adsorption occurs by π-complexation. A further method includes selective removal of aromatic compounds from a mixture of aromatic and aliphatic compounds. |
| FILED | Wednesday, December 03, 2003 |
| APPL NO | 10/726935 |
| ART UNIT | 1764 — Organic Chemistry, Polymers, Compositions |
| CURRENT CPC | Mineral oils: Processes and products 28/250 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094622 | Cui et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Louisiana Tech University Foundation, Inc. (Ruston, Louisiana) |
| INVENTOR(S) | Tianhong Cui (Ruston, Louisiana); Jing Wang (Ruston, Louisiana); Yongjun Zhao (Ruston, Louisiana) |
| ABSTRACT | A process for fabricating a polymer based circuit by the following steps. A mold of a design is formed through a lithography process. The design is transferred to a polymer substrate through a hot embossing process. A metal layer is then deposited over at least part of said design and at least one electrical lead is connected to said metal layer. |
| FILED | Wednesday, August 27, 2003 |
| APPL NO | 10/648927 |
| ART UNIT | 2822 — Semiconductors/Memory |
| CURRENT CPC | Semiconductor device manufacturing: Process 438/57 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095540 | Javidi et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The University of Connecticut (Farmington, Connecticut) |
| INVENTOR(S) | Bahram Javidi (Storrs, Connecticut); Ahouzi Esmail (Rabat, Morocco); Guanshen (Eric) Zhang (Reston, Virginia) |
| ABSTRACT | A method of verifying the authenticity of an object is presented. The method comprises providing a primary image; providing a secondary image; encoding the primary image; providing a random code; convolving the encoded primary image with the random code, providing thereby a reference image; affixing the reference image to the object to be authenticated; transforming the reference image; and comparing the transformed reference image with the secondary image. A system for verifying the authenticity of an object is presented. The system comprises a signal source; a first subsystem receiving a first signal from the signal source and providing as output therefrom a first output signal; a second subsystem receiving a second signal from the signal source and providing as output therefrom a second output signal; a third subsystem receiving the first and second output signals for comparing the first output signal with the second output signal. |
| FILED | Friday, January 28, 2000 |
| APPL NO | 09/493692 |
| ART UNIT | 2872 — Optics |
| CURRENT CPC | Optical: Systems and elements 359/29 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07095772 | Delfyett et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Research Foundation of the University of Central Florida, Inc. (Orlando, Florida) |
| INVENTOR(S) | Peter J. Delfyett (Geneva, Florida); Kyungbum Kim (Orlando, Florida); Bojan Resan (Orlando, Florida) |
| ABSTRACT | Methods, devices and systems for generating ultrashort optical linear chirped pulses with very high power by amplifying the pulses so that their temporal duration is longer than the storage time of the amplifying medium. The additional gain factor is related to the ratio of the storage time to the stretched pulse. A preferred embodiment connects a mode locked laser source that generates optical pulses whose duration is stretched with a chirped fiber Bragg grating. Embodiments include methods, devices and systems causing an extreme chirped pulse amplifier (XCPA) effect in an oscillator. |
| FILED | Wednesday, April 21, 2004 |
| APPL NO | 10/828965 |
| ART UNIT | 2828 — Semiconductors/Memory |
| CURRENT CPC | Coherent light generators 372/50.220 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07096328 | Yao et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Southern California (Los Angeles, California) |
| INVENTOR(S) | Shu-Yuen Didi Yao (Los Angeles, California); Cyrus Shahabi (Irvine, California); Roger Zimmermann (Walnut, California) |
| ABSTRACT | Systems and techniques to pseudorandomly place and redistribute data blocks in a storage system. In general, in one implementation, the techniques include: distributing data blocks over multiple storage devices according to a reproducible pseudorandom sequence that provides load balancing across the storage devices, and determining current storage locations of the data blocks by reproducing the pseudorandom sequence. The techniques may also include: distributing data blocks over multiple storage devices according to a reproducible pseudorandom sequence, in response to initiation of a storage scaling operation, pseudorandomly redistributing a selected subset of the data blocks and saving information describing the storage scaling operation, determining current storage locations based on the pseudorandom sequence and the saved scaling operation information, and accessing the data blocks according to the determined current storage locations. |
| FILED | Friday, January 24, 2003 |
| APPL NO | 10/351269 |
| ART UNIT | 2187 — Computer Architecture and I/O |
| CURRENT CPC | Electrical computers and digital processing systems: Memory 711/157 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Agriculture (USDA)
| US 07094953 | Wright et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Iowa State University Research Foundation, Inc. (Ames, Iowa) |
| INVENTOR(S) | David A. Wright (Boone, Iowa); Daniel F. Voytas (Ames, Iowa) |
| ABSTRACT | The present invention provides nucleic acids, as well as vectors, cells, and plants (including plant parts, seeds, and embryos) containing the nucleic acids. In particular, molecular tools are provided in the form of nucleic acids that encode reverse transcriptases. The invention also features methods for manipulating such nucleic acids. In addition, the invention features methods to introduce nucleic acids containing retroelements or retroelement sequences into cells. |
| FILED | Monday, March 24, 2003 |
| APPL NO | 10/395607 |
| ART UNIT | 1636 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Multicellular living organisms and unmodified parts thereof and related processes 8/298 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Transportation (USDOT)
| US 07094532 | Robertson et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Vanderbilt University (Nashville, Tennessee) |
| INVENTOR(S) | David Robertson (Nashville, Tennessee); Randy D. Blakely (Brentwood, Tennessee) |
| ABSTRACT | Isolated polynucleotide molecules and peptides encoded by these molecules are used in the analysis of human norepinephrine (NE) transporter variants, as well as in diagnostic and therapeutic applications, relating to a human NE transporter polymorphism. By analyzing genomic DNA or amplified genomic DNA, or amplified cDNA derived from mRNA, it is possible to type a human NE transporter with regard to the human NE transporter polymorphism, for example, in the context of diagnosing and treating NE transport impairments, and disorders associated with NE transport impairments, such as orthostatic intolerance. |
| FILED | Thursday, December 28, 2000 |
| APPL NO | 09/750609 |
| ART UNIT | 1637 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/6 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of the Interior (DOI)
| US 07094341 | Max |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Marine Desalination Systems, L.L.C. (Washington, District of Columbia) |
| INVENTOR(S) | Michael David Max (St. Pete Beach, Florida) |
| ABSTRACT | Processes and apparatus are disclosed for separating and purifying aqueous solutions such as seawater by causing a substantially impermeable mat of gas hydrate to form on a porous restraint. Once the mat of gas hydrate has formed on the porous restraint, the portion of the mat of gas hydrate adjacent to the restraint is caused to dissociate and flow through the restraint, e.g., by lowering the pressure in a collection region on the opposite side of the restraint. The purified or desalinated water may then be recovered from the collection region. The process may be used for marine desalination as well as for drying wet gas and hydrocarbon solutions. If conditions in the solution are not conductive to forming hydrate, a heated or refrigerated porous restraint may be used to create hydrate-forming conditions near the restraint, thereby causing gas hydrates to form directly on the surface of the restraint. |
| FILED | Friday, March 25, 2005 |
| APPL NO | 11/089369 |
| ART UNIT | 1724 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Liquid purification or separation 210/170 |
| VIEW PATENT | @ USPTO: Full Text PDF |
National Geospatial Intelligence Agency (NGA)
| US 07095540 | Javidi et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The University of Connecticut (Farmington, Connecticut) |
| INVENTOR(S) | Bahram Javidi (Storrs, Connecticut); Ahouzi Esmail (Rabat, Morocco); Guanshen (Eric) Zhang (Reston, Virginia) |
| ABSTRACT | A method of verifying the authenticity of an object is presented. The method comprises providing a primary image; providing a secondary image; encoding the primary image; providing a random code; convolving the encoded primary image with the random code, providing thereby a reference image; affixing the reference image to the object to be authenticated; transforming the reference image; and comparing the transformed reference image with the secondary image. A system for verifying the authenticity of an object is presented. The system comprises a signal source; a first subsystem receiving a first signal from the signal source and providing as output therefrom a first output signal; a second subsystem receiving a second signal from the signal source and providing as output therefrom a second output signal; a third subsystem receiving the first and second output signals for comparing the first output signal with the second output signal. |
| FILED | Friday, January 28, 2000 |
| APPL NO | 09/493692 |
| ART UNIT | 2872 — Optics |
| CURRENT CPC | Optical: Systems and elements 359/29 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Small Business Administration (SBA)
| US 07096412 | Chen et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | TrellisWare Technologies, Inc. (San Diego, California) |
| INVENTOR(S) | Xiaopeng Chen (Sunnyvale, California); Keith M. Chugg (Burbank, California) |
| ABSTRACT | In a digital information processing system wherein a model of a finite state machine (FSM) receiving a plurality of FSM inputs and producing a plurality of FSM outputs is represented by a reduced-state trellis and wherein the FSM inputs are defined on a base closed set of symbols, a novel method is presented for updating soft decision information on the FSM inputs into higher confidence information whereby (1) the soft decision information is inputted in a first index set, (2) a forward recursion is processed on the input soft decision information based on the reduced-state trellis representation to produce forward state metrics, (3) a backward recursion is processed on the input soft decision information based on the reduced-state trellis representation to produce backward state metrics, wherein the backward recursion is independent of the forward recursion and (4) the forward state metrics and the backward state metrics are operated on to produce the higher confidence information. |
| FILED | Thursday, June 14, 2001 |
| APPL NO | 09/882283 |
| ART UNIT | 2133 — Memory Access and Control |
| CURRENT CPC | Error detection/correction and fault detection/recovery 714/794 |
| VIEW PATENT | @ USPTO: Full Text PDF |
U.S. State Government
| US 07095285 | Heston et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Raytheon Company (Waltham, Massachusetts) |
| INVENTOR(S) | David D. Heston (Dallas, Texas); John G. Heston (Murphy, Texas); Brian P. Helm (Sachse, Texas); Gordon R. Scott (Plano, Texas); Scott Mitchel Heston (Dallas, Texas); David R. Fletcher (Allen, Texas); William S. Kopp (Greensboro, North Carolina) |
| ABSTRACT | According to one embodiment of the present invention a method for biasing a power amplifier having at least one transistor exhibiting kink anomaly includes providing a bias circuit coupled to a gate of at least one transistor of the power amplifier. The method also includes providing, by the bias circuit, a bias voltage to the gate. The bias circuit has a load characteristic that intersects a current versus gate voltage curve for the gate at a frequency of operation of the power amplifier only once and that exhibits a low impedance at the intersection of the load characteristic with the current versus gate curve of the gate. |
| FILED | Monday, July 26, 2004 |
| APPL NO | 10/901416 |
| ART UNIT | 2817 — Semiconductors/Memory |
| CURRENT CPC | Amplifiers 330/296 |
| VIEW PATENT | @ USPTO: Full Text PDF |
United States Postal Service (USPS)
| US 07095323 | Darty |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States Postal Service (Washington, District of Columbia) |
| INVENTOR(S) | Harry Darty (St. Charles, Maryland) |
| ABSTRACT | A mail collection point-of-use for and method of preventing detected hazardous materials within a mail collection point-of-use from contaminating components of subsequent mail delivery system processes. The mail collection point-of-use comprises a mail drop unit having an opening for receiving customer-deposited mail, a mail receptacle for accumulating received mail, an enclosure coupled to the mail drop unit and containing the mail receptacle and having a door that seals an opening large enough to permit removal of the mail receptacle, a detector inside the enclosure, which generates a detection signal upon detection of airborne hazardous material, and an indicator outside the enclosure for indicating the detection of hazardous material. By indicating the detection of hazardous materials within the mail collection point-of-use before removing the mail receptacle and its contaminated mail, the further spread of the hazardous materials in a mail delivery system may be prevented. |
| FILED | Friday, August 01, 2003 |
| APPL NO | 10/632466 |
| ART UNIT | 2636 — Optical Communications |
| CURRENT CPC | Communications: Electrical 340/569 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Government Rights Acknowledged
| US 07093802 | Pitzer et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Boeing Company (Chicago, Illinois) |
| INVENTOR(S) | Jon W. Pitzer (Kent, Washington); Mark Olsen (North Bend, Washington) |
| ABSTRACT | A jet aircraft with integrated, rotary sonobuoy launch system has storage racks for a number of sonobuoys in sonobuoy launch containers; and one or more launcher units in its cabin. Each launcher unit has a pressure shell with a door allowing loading of sonobuoys in sonobuoy launch containers from the storage racks. With the door closed, the inside of the shell can be depressurized for launching a sonobuoy by opening a gate valve that connects the interior of the shell to the exterior of the aircraft. With the gate valve closed, the shell can pressurized so that the door can be opened and sonobuoys reloaded. A control system can be used to rotate a rotary launcher inside each pressure shell so that a selected sonobuoy is moved to a launch position above the gate valve and a launch tube, and a pneumatic system can be used to launch the sonobuoy. |
| FILED | Friday, October 15, 2004 |
| APPL NO | 10/966201 |
| ART UNIT | 3644 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Aeronautics and astronautics 244/137.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094222 | Siekas et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of Navy (Washington, District of Columbia) |
| INVENTOR(S) | Jeremy John Siekas (Portland, Oregon); Deborah Valerie Pence (Corvallis, Oregon); James Anthony Liburdy (Philomath, Oregon) |
| ABSTRACT | A syringe device includes a first chamber defined by a cylindrical barrel, a plunger head within the barrel and a hollow needle sealed to an administering end of the barrel but open to an environment outside of the first chamber. A second chamber is defined by the barrel, the plunger head and a seal that seals around a plunger shaft leading to the plunger head and that seals an actuation end of the barrel. A receiving container having a second hollow needle attached and sealed at one end is also attached and sealed to the syringe, to thereby define a receiving chamber in fluid communication with the second chamber of the syringe and, via the second needle, with an environment outside of the receiving chamber. Depressing the plunger will infuse a substance through the first needle while simultaneously withdrawing a substance through the second needle. Reverse action is possible. |
| FILED | Monday, April 28, 2003 |
| APPL NO | 10/425790 |
| ART UNIT | 3763 — Refrigeration, Vaporization, Ventilation, and Combustion |
| CURRENT CPC | Surgery 64/191 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094543 | Li-Sucholeiki et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Massachusetts Institute of Technology (Cambridge, Massachusetts) |
| INVENTOR(S) | Xiao-Cheng Li-Sucholeiki (Winchester, Massachusetts); Elena Viktorovna Gostjeva (Winchester, Massachusetts); William G. Thilly (Winchester, Massachusetts) |
| ABSTRACT | Methods for detecting low frequency nuclear mutations in a target sequence from a genomic DNA sequence are disclosed. |
| FILED | Friday, October 04, 2002 |
| APPL NO | 10/265653 |
| ART UNIT | 1634 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/6 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094551 | Zahradnik et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | |
| INVENTOR(S) | Richard J. Zahradnik (Dana Point, California); Jeffrey Lavigne (San Juan Capistrano, California); Harald Jueppner (Cambridge, Massachusetts) |
| ABSTRACT | Immunoassays, assay methods, antibodies and methods of producing antibodies for the detection of fibroblast growth factor-23 (FGF-23). The immunoassay and assay method preferably comprise a non-competitive, sandwich-type assay utilizing a first bound antibody having affinity to a first site of the FGF-23 molecule, and a second, labeled antibody having an affinity for a second site present upon the FGF-23 molecule. The antibodies and methods of generating the same include administering antigenic peptide fragments of the FGF-23 molecule, monitoring the antibody titre produced thereby, extracting and selecting antibodies from the antisera having a specificity for the desired antigenic region of FGF-23, and purifying same. The antibodies may be incorporated into the immunoassay of the present invention or utilized for a variety of assay-type purposes for the detection of FGF-23. |
| FILED | Tuesday, September 17, 2002 |
| APPL NO | 10/245141 |
| ART UNIT | 1644 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/7.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07094593 | Pausch et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | BASF Aktiengesellschaft (, Germany); The United States of America as represented by the Department of Health (Washington, District of Columbia) |
| INVENTOR(S) | Mark Henry Pausch (Rocky Hill, New Jersey); Jurgen Wess (Bethesda, Maryland) |
| ABSTRACT | This invention relates to mutant G protein-coupled receptors with improved G-protein coupling and receptor response, yeast cells expressing such receptors, vectors useful for making such cells, and methods of making and using same. |
| FILED | Wednesday, September 01, 1999 |
| APPL NO | 09/786033 |
| ART UNIT | 1649 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/254.110 |
| VIEW PATENT | @ USPTO: Full Text PDF |
How To Use This Page
THE FEDINVENT PATENT DETAILS PAGE
Each week, FedInvent analyzes newly granted patents and published patent applications whose origins lead back to funding by the US Federal Government. The FedInvent Patent Details page is a companion to the weekly FedInvents Patents Report.
This week's information is published in the FedInvent Patents report for Tuesday, August 22, 2006.
The FedInvent Weekly Patent Details Page contains a subset of patent information to provide a deeper dive into the week’s taxpayer-funded patents to help the reader better understand where a patent fits in the federal innovation ecosphere.
HOW IS THE INFORMATION ORGANIZED?
Patents are organized by the funding agency. Within each group, the patents are organized in numeric order. A patent funded by more than one agency will appear in the section of each of the agencies that funded the research and development that resulted in the invention. This approach gives the reader a complete view of the department or agency activity for the week.
WHAT INFORMATION WILL I FIND?
THE PANEL
There is a panel for each patent that contains the patent number and the title of the patent. When you click the panel, it opens to reveal the following information:
FUNDED BY
The agencies that funded the grants, contracts, or other research agreements that resulted in the patent. FedInvent includes as much information on the source of the funding as possible. The information is presented in a hierarchy going from the Federal Department down to the agencies, subagencies, and offices that funded the work. Here are two examples:
Department of Health and Human Services (HHS)
National Institutes of Health (NIH)
National Institute of Diabetes and Digestive and Kidney Diseases (NIDDK)
Department of Defense (DOD)
Defense Advanced Research Projects Agency (DARPA)
Army Research Office (ARO)
We do our best to provide detailed information about the funding. In some cases, the patent only reports limited information on the origins of the funding. FedInvents presents what it can confirm. We add the patents without the information required by the Bayh-Dole Act to our list of patents worthy of further investigation.
APPLICANT(S) and ASSIGNEES
FedInvent includes both the Applicants and the Assignees because having both provides more information about where the inventive work was done and by what organizations. Many organizations — universities, corporations, and federal agencies — standardize the Assignee/Owner information by the time a patent is granted. In the case of federal patents, many of the patents use the agency headquarters information for patent assignment.
Showing just the headquarters address would make Washington, DC the epicenter of all taxpayer-funded research and development. Providing both the applicant information and the assignee information provides a more accurate picture of where important taxpayer funded innovation is happening in America. Here are two examples from two different patents:
APPLICANT: U.S. Army Research Laboratory, Adelphi, MD
ASSIGNEE: The United States of America as represented by the Secretary of the Army Washington, DC
APPLICANT: Optech Ventures, LLC (Torrance, California)
ASSIGNEE(S): The Regents of the University of California (Oakland, California); Optech Ventures, LLC (Torrance, California)
INVENTOR(S)
The inventors appear in the same order as they appear on the patent. FedInvents presents the names in first name/last name order because they are easier to read than the last name/first name order of the names on the USPTO patent documents.
ABSTRACT
The abstract as it appears on the patent.
FILED
The date of the patent application including the day of the week.
APPL NO
This is the patent application serial number. If you’d like to learn more about how application serial numbers work you can go to the Lists Page.
ART UNIT
Patent data includes the Art Unit where a patent was examined. (The Art Unit isn’t available for published patent applications.) The Art Unit provides insight into what group of patent examiners prosecuted the patent application and the subject matter that the examiners work on. For example:
3793 — Medical Instruments, Diagnostic Equipment, and Treatment Devices
You can learn more about ART UNITS on the FedInvent Patents Weekly panel called About Tech Center or you can find information on the FedInvent Lists Page.
CURRENT CPC
Current CPC provides a list of the Cooperative Patent Classification symbols assigned to the patent. These are the CPC symbols assigned at the time the patent was granted.
The FedInvent Project is a patent classification maximalist endeavor or put another way, we believe that more you understand about patent classification the more you'll learn about the nature of the invention and the types of work that the federal government is funding.
The symbol presented in BOLD is the symbol identified as the "first" classification which is the most relevant classification on the patent. The date that follows the symbol is the date of the most recent revision to the art classed there.
- A61B 1/149 (20130101)
- A61B 1/71 (20130101)
- A61B 1/105 (20130101)
The CPC symbols match the classifications found on the PDF version of the patent. Over time, the classifications on the full-text version of the patent change to reflect how USPTO organizes patent art to support its examiners. The two sets of CPCs don’t always match.
VIEW PATENT
As of June 2021, we include two ways to view a patent at USPTO. FedInvent provides a link to the Full-Text Version of the patent and a link to the PDF version of the patent.
HOW DO I FIND A SPECIFIC PATENT ON A PAGE?
You can use the Command F or Control F to find a specific patent you are interested in.
HOW DO I GET HERE?
You navigate to the details of a patent by clicking the information icon that follows a patent on the FedInvent Patents Weekly Report.
You can also reach this page using the weekly page link that looks like this:
https://wayfinder.digital/fedinvent/patents-2006/fedinvent-patents-20060822.html
Just update the date portion of the URL. Tuesdays for patents. Thursdays for pre-grant publication of patent applications.
Download a copy of the How To Use This Page