FedInvent™ Patents
Patent Details for Tuesday, August 10, 2010
This page was updated on Monday, March 27, 2023 at 01:52 AM GMT
Department of Defense (DOD)
| US 07770380 | Dulligan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | |
| INVENTOR(S) | Michael Dulligan (Lancaster, California); James Lake (Punta Gorda, Florida); Paul Adkison (California City, California); Greg Spanjers (Sandig Park, New Mexico); David White (Rosamond, California); Hieu Nguyen (Palmdale, California) |
| ABSTRACT | An apparatus and method to control ignition, combustion burn rate, extinguishment, and reignition of solid propellant is provided. |
| FILED | Monday, January 13, 2003 |
| APPL NO | 10/342003 |
| ART UNIT | 3643 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Power plants 060/254 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07770399 | Burdick et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | United Technologies Corporation (Hartford, Connecticut) |
| INVENTOR(S) | Andrew D. Burdick (Ellington, Connecticut); Kyle J. Osga (Windham, Connecticut); Paul R. Senofonte (Portland, Connecticut); Richard F. Norman (West Warren, Massachusetts); Alex J. Simpson (Manchester, Connecticut) |
| ABSTRACT | A gas turbine engine has the convergent flaps and seals of an adjustable cross-sectional area nozzle connected to associated liners with a thermally compliant bracket. The bracket includes spaced feet with an intermediate notch spaced away from the liner. In this manner, a temperature gradient along the liner can be easily compensated at the connection of the bracket to the liner by adjustment within the notch. In other features, the bracket is riveted to the liner, providing further resistance to thermal expansion due to temperature gradiations. |
| FILED | Friday, September 29, 2006 |
| APPL NO | 11/540310 |
| ART UNIT | 3741 — Thermal & Combustion Technology, Motive & Fluid Power Systems |
| CURRENT CPC | Power plants 060/770 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771160 | Shi et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | United Technologies Corporation (Hartford, Connecticut) |
| INVENTOR(S) | Jun Shi (Glastonbury, Connecticut); Shaoluo L. Butler (Manchester, Connecticut); Kevin E. Green (Broad Brook, Connecticut) |
| ABSTRACT | A ceramic shroud assembly suitable for use in a gas turbine engine comprises a metal clamp ring shrink fitted around a ceramic shroud ring and an insulating and compliant interlayer. The interlayer is positioned between the metal clamp ring and the ceramic shroud ring. |
| FILED | Thursday, August 10, 2006 |
| APPL NO | 11/502212 |
| ART UNIT | 3745 — Thermal & Combustion Technology, Motive & Fluid Power Systems |
| CURRENT CPC | Rotary kinetic fluid motors or pumps 415/138 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771173 | Leahy et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Sikorsky Aircraft Corporation (Stratford, Connecticut) |
| INVENTOR(S) | Kevin P. Leahy (Naugatuck, Connecticut); Richard Joseph Simkulak (Meriden, Connecticut); Wonsub Kim (Orange, Connecticut) |
| ABSTRACT | A main rotor blade assembly includes a tip cap removably mountable to an outboard end section of a forward tip spar section and an aft tip spar section. |
| FILED | Friday, April 04, 2008 |
| APPL NO | 12/062807 |
| ART UNIT | 3745 — Thermal & Combustion Technology, Motive & Fluid Power Systems |
| CURRENT CPC | Fluid reaction surfaces 416/224 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771208 | Hougham et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | International Business Machines Corporation (Armonk, New York) |
| INVENTOR(S) | Gareth Geoffrey Hougham (Ossining, New York); Ali Afzali (Ossining, New York); Steven Allen Cordes (Yorktown Heights, New York); Paul W. Coteus (Yorktown, New York); Matthew J. Farinelli (Riverdale, New York); Sherif A. Goma (White Plains, New York); Alphonso P. Lanzetta (Marlboro, New York); Daniel Peter Morris (Purchase, New York); Joanna Rosner (Cortlandt Manor, New York); Nisha Yohannan (Yonkers, New York) |
| ABSTRACT | Techniques for forming enhanced electrical connections are provided. In one aspect, an electrical connecting device comprises an electrically insulating carrier having one or more contact structures traversing a plane thereof. Each contact structure comprises an elastomeric material having an electrically conductive layer running along at least one surface thereof continuously through the plane of the carrier. |
| FILED | Tuesday, May 27, 2008 |
| APPL NO | 12/127418 |
| ART UNIT | 2833 — Electrical Circuits and Systems |
| CURRENT CPC | Electrical connectors 439/66 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771549 | Christe et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | United States of America as represented by the Secretary of the Air Force (Washington, District of Columbia) |
| INVENTOR(S) | Karl O. Christe (Calabasas, California); Greg W. Drake (Palmdale, California) |
| ABSTRACT | Provided are energetic materials of low vapor pressure in the form of ionic liquids having fuel and oxidizer ions including, substituted pyridinium or imidazolium cations paired with nitrato-, perchlorato-, or nitramido-based anions, to form such ionic liquids or salts. The salts of the present invention are low melting and have essentially little or no vapor pressure over a wide temperature range. The salts of this invention are thus an important breakthrough since they can serve as high-performing monopropellants which are not complex mixtures and have no vapor toxicity. Such salts also find use as munitions, liquid explosives, reaction media for the synthesis of other high-energy materials, and as plasticizers. |
| FILED | Tuesday, October 07, 2003 |
| APPL NO | 10/681502 |
| ART UNIT | 1793 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Explosive and thermic compositions or charges 149/1 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771580 | Daniel et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Palo Alto Research Center Incorporated (Palo Alto, California) |
| INVENTOR(S) | Jurgen H. Daniel (San Francisco, California); Meng H. Lean (Santa Clara, California); Robert Matusiak (Sunnyvale, California); Armin R. Volkel (Mountain View, California); Gregory P. Schmitz (Los Gatos, California); Huangpin B. Hsieh (Mountain View, California); Ashutosh Kole (Sunnyvale, California) |
| ABSTRACT | Method and Systems for extracting a concentrated sample of particles include priming a concentrate reservoir by passing a fluid through the concentrate reservoir to remove air. The concentrate reservoir has a first end with an opening and second end with an opening. The second end of the concentrate reservoir is closed off, and particles are accumulated within the concentrate reservoir by use of a particle concentrator. Thereafter, the first end of the concentrate reservoir is closed off, isolating the concentrate reservoir from particle concentrator, from which the particles were obtained. The second end of the concentrate reservoir is thereafter opened, and the particles of the concentrated sample in the concentrate reservoir are extracted to a sample capture reservoir through the second end opening of the concentrate reservoir. |
| FILED | Wednesday, August 30, 2006 |
| APPL NO | 11/468523 |
| ART UNIT | 1795 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Electrolysis: Processes, compositions used therein, and methods of preparing the compositions 25/547 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771630 | Hartmann et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Daniel M. Hartmann (La Jolla, California); Sadik C. Esener (San Diego, California); Osman Kibar (San Diego, California) |
| ABSTRACT | High performance microlens arrays are fabricated by (i) depositing liquid on the hydrophilic domains of substrates of patterned wettability by either (a) condensing liquid on the domains or (b) withdrawing the substrate from a liquid solution and (ii) optionally curing the liquid to form solid microlenses. The f-number (f#) of formed microlenses is controlled by adjusting liquid viscosity, surface tension, density, and index of refraction, as well as the surface free energies of the hydrophobic and hydrophilic areas. The f-number of formed microlenses is also adjustable by controlling substrate dipping angle and withdrawal speed, the array fill factor and the number of dip coats used. At an optimum withdrawal speed f# is minimized and array uniformity is maximized. At this optimum, arrays of f/3.48 microlenses were fabricated using one dip-coat with uniformity better than Δf/f˜±3.8% while multiple dip-coats permit production of f/1.38 microlens arrays and uniformity better than Δf/f˜±5.9%. Average f#s are reproducible to within 3.5%. The method is adaptable and extendible to precision parallel fabrication of (i) microlenses precisely sized, aligned and spatially positioned to various small light sources and optical fiber ends, (ii) conductive bump bonds on substrate pads, and (iii) conductive bonds between corresponding domains on separate perpendicular substrates, all of which are self-aligned. |
| FILED | Friday, February 23, 2001 |
| APPL NO | 09/792236 |
| ART UNIT | 1791 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Plastic and nonmetallic article shaping or treating: Processes 264/1.380 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771647 | Jacobs et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | President and Fellows of Harvard College (Cambridge, Massachusetts) |
| INVENTOR(S) | Heiko O. Jacobs (Minneapolis, Minnesota); George M. Whitesides (Newton, Massachusetts) |
| ABSTRACT | A method and apparatus for providing electric microcontact printing is provided. A stamp is brought into contact with the surface of a substrate to provide high resolution features. Aspects of the invention may be used for data storage, microcontact printing, and for other applications requiring high resolution pattern transfer. |
| FILED | Wednesday, December 11, 2002 |
| APPL NO | 10/316997 |
| ART UNIT | 1785 — Miscellaneous Articles, Stock Material |
| CURRENT CPC | Plastic and nonmetallic article shaping or treating: Processes 264/435 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771689 | Sunkara et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Louisville Research Foundation, Inc (Louisville, Kentucky) |
| INVENTOR(S) | Mahendra Kumar Sunkara (Louisville, Kentucky); Hari Chandrasekaran (Louisville, Kentucky); Hongwei Li (Louisville, Kentucky) |
| ABSTRACT | A process of synthesizing metal and metal nitride nanowires, the steps comprising of: forming a catalytic metal (such as gallium, and indium) on a substrate (such as fused silica quartz, pyrolytic boron nitride, alumina, and sapphire), heating the combination in a pressure chamber, adding gaseous reactant and/or solid metal source, applying sufficient microwave energy (or current in hot filament reactor) to activate the metal of interest (such as gold, copper, tungsten, and bismuth) and continuing the process until nanowires of the desired length are formed. The substrate may be fused silica quartz, the catalytic metal a gallium or indium metal, the gaseous reactant is nitrogen and/or hydrogen and the nanowires are tungsten nitride and/or tungsten. |
| FILED | Monday, November 10, 2003 |
| APPL NO | 10/705687 |
| ART UNIT | 1793 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Chemistry of inorganic compounds 423/409 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771696 | Wang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Dayton (Dayton, Ohio) |
| INVENTOR(S) | David H. Wang (Beavercreek, Ohio); Loon-Seng Tan (Centerville, Ohio) |
| ABSTRACT | A composition is provided in which carbon nanofibers are functionalized with at least one moiety where the moiety or moieties comprise at least one bivalent radical. The composition can include a nanocomposite, such as polyimide films. Methods for making functionalized carbon nanofibers and nanocomposites are also provided. |
| FILED | Thursday, July 27, 2006 |
| APPL NO | 11/494041 |
| ART UNIT | 1793 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Chemistry of inorganic compounds 423/447.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771793 | Wynne et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Virginia Commonwealth University (Richmond, Virginia); The United States of America as represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | Kenneth Joseph Wynne (Midlothian, Virginia); Biao Duan (Richmond, Virginia); Steven Grunzinger (Tokyo, Japan); Umit Makal (Strongsville, Ohio); Pinar Kurt (Richmond, Virginia); James Wynne (Alexandria, Virginia) |
| ABSTRACT | Polymers, and particularly conventional commodity bulk polymers, are modified to have a surface activity of interest using a surface modifying polymer that includes a moiety that favors migration to the surface of the bulk polymer together with a moiety provides the activity of interest (e.g., biocidal, wettability modifying (hydrophobic or hydrophilic), resistance to radiant energy, providing a functional group for functionalizing the surface, etc.). The surface modifying polymer is combined with the bulk polymer, and, due to the presence of the moiety that favors migration, concentrates primarily on the surface of the bulk polymer such that the moiety that provides the activity of interest is located primarily on the surface of the bulk polymeric article which is produced. Advantageously, only a minimal amount (such as, e.g., about 2 weight %) of polymeric surface modifier is needed. Being able to achieve desired properties (such as biocidal activity, wettability modification, etc.) without needing much polymeric surface modifier is highly advantageous. |
| FILED | Thursday, December 01, 2005 |
| APPL NO | 11/290803 |
| ART UNIT | 1794 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Coating processes 427/401 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771825 | Wynne et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Virginia Commonwealth University (Richmond, Virginia) |
| INVENTOR(S) | Kenneth Joseph Wynne (Midlothian, Virginia); Biao Duan (Richmond, Virginia); Steven Grunzinger (Tokyo, Japan); Umit Makal (Strongsville, Ohio); Pinar Kurt (Richmond, Virginia) |
| ABSTRACT | Polymers, and particularly conventional commodity bulk polymers, are modified to have a surface activity of interest using a surface modifying polymer that includes a moiety that favors migration to the surface of the bulk polymer together with a moiety provides the activity of interest (e.g., biocidal, wettability modifying (hydrophobic or hydrophilic), resistance to radiant energy, providing a functional group for functionalizing the surface, etc.). The surface modifying polymer is combined with the bulk polymer, and, due to the presence of the moiety that favors migration, concentrates primarily on the surface of the bulk polymer such that the moiety that provides the activity of interest is located primarily on the surface of the bulk polymeric article which is produced. Advantageously, only a minimal amount (such as, e.g., about 2 weight %) of polymeric surface modifier is needed. Being able to achieve desired properties (such as biocidal activity, wettability modification, etc.) without needing much polymeric surface modifier is highly advantageous. |
| FILED | Tuesday, March 14, 2006 |
| APPL NO | 11/374421 |
| ART UNIT | 1794 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Stock material or miscellaneous articles 428/411.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771833 | Ja Chisholm et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | NDSU Research Foundation (Fargo, North Dakota) |
| INVENTOR(S) | Bret Ja Chisholm (West Fargo, North Dakota); Philip Boudjouk (Fargo, North Dakota); Johnson Thomas (Fargo, North Dakota); David Allen Christianson (Fargo, North Dakota); Shane Jeremy Stafslien (Fargo, North Dakota) |
| ABSTRACT | Polyamine cross-linked polysiloxanes, such as functionalized polysiloxane cross-linked with a polyalkylenepolyamine are described herein. The polyamine cross-linked polysiloxanes may be used in an antifouling composition to prevent biological fouling in marine environments. |
| FILED | Monday, May 08, 2006 |
| APPL NO | 11/429923 |
| ART UNIT | 1796 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Stock material or miscellaneous articles 428/447 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771846 | Viehland et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Virginia Tech Intellectual Properties, Inc. (Blacksburg, Virginia) |
| INVENTOR(S) | Dwight Viehland (Blacksburg, Virginia); Shuxiang Dong (Blacksburg, Virginia); Jie-Fang Li (Blacksburg, Virginia); Junyi Zhai (Blacksburg, Virginia) |
| ABSTRACT | An ME composite laminate of at least one (1-3) piezo-fiber layer coupled with high-permeability alloy magnetostrictive layers, optionally formed of FeBSiC or equivalent. The composite laminate alternates the (1-3) piezo-fiber and high-permeability alloy magnetostrictive layers in a stacked manner. Optionally, the magnetization direction of the high-permeability alloy magnetostrictive layers and polarization direction of the piezo-fiber layer are an (L-L) arrangement. Optionally, thin film polymer layers are between the (1-3) piezo-fiber layer and high-permeability alloy magnetostrictive layers. Optionally, piezo-electric fibers within the (1-3) piezo-fiber layer are poled by inter-digitated electrodes supported by the thin film polymer, arranged as alternating symmetric longitudinally-poled “push-pull” units. |
| FILED | Wednesday, August 01, 2007 |
| APPL NO | 11/832564 |
| ART UNIT | 1785 — Miscellaneous Articles, Stock Material |
| CURRENT CPC | Stock material or miscellaneous articles 428/693.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771935 | Liu et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | President and Fellows of Harvard College (Cambridge, Massachusetts) |
| INVENTOR(S) | David R. Liu (Lexington, Massachusetts); Zev J. Gartner (Santa Cruz, California); Christopher T. Calderone (Cambridge, Massachusetts) |
| ABSTRACT | Nature evolves biological molecules such as proteins through iterated rounds of diversification, selection, and amplification. The power of Nature and the flexibility of organic synthesis are combined in nucleic acid-templated synthesis. The present invention provides a variety of template architectures for performing nucleic acid-templated synthesis, methods for increasing the selectivity of nucleic acid-templated reactions, methods for performing stereoselective nucleic acid-templated reactions, methods of selecting for reaction products resulting from nucleic acid-templated synthesis, and methods of identifying new chemical reactions based on nucleic acid-templated synthesis. |
| FILED | Friday, September 24, 2004 |
| APPL NO | 10/950367 |
| ART UNIT | 1637 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/6 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772288 | Wu et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Cornell Research Foundation, Inc. (Ithaca, New York) |
| INVENTOR(S) | Huaqiang Wu (Mountain View, California); Michael G. Spencer (Ithaca, New York); Emmanuel Giannelis (Ithaca, New York); Athanasios Bourlinos (Ithaca, New York) |
| ABSTRACT | The invention provides a composition that is a dispersion made from a Group III nitride, a solvent system, and a dispersant. The dispersion can be used to prepare Group III nitride thin films on a wide range of substrates, for example, glass, silicon, silicon dioxide, silicon nitride, silicon carbide, aluminum nitride, sapphire, and organic polymers. The particle size of the Group III nitride used for producing the thin films can be controlled by adjusting centrifugation of the dispersion and selecting a desired layer of supernatant. The dispersant can be removed from the thin films by calcination. The Group III nitride can contain a dopant. Doped Group III nitride thin films can emit visible light upon irradiation. Green, red, and yellow light emissions result from irradiating erbium-, europium-, and cerium-doped gallium nitride, respectively. |
| FILED | Friday, June 01, 2007 |
| APPL NO | 11/809879 |
| ART UNIT | 1796 — Organic Chemistry |
| CURRENT CPC | Colloid systems and wetting agents; subcombinations thereof; processes of 516/33 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772355 | Laskoski et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | Matthew Laskoski (Springfield, Virginia); Teddy M Keller (Fairfax Station, Virginia) |
| ABSTRACT | A compound having the formula: Each Ar is an aromatic group. Each R is an alkyl group. The value n is a positive integer. The values of w, x, y, and z are 0 or 1. If y is 0 than x and z are 0 and w is 1, and if y is 1 than x and z have different values and w equals z. A thermoset made by crosslinking a silane-containing compound with the above compound. A method of making the above compound when y is 1 by: reacting 4,4′-difluorobenzophenone with an aromatic diol to form an oligomer; and reacting the oligomer with a vinyl dialkylsilane. A method of making the below compound by: reacting 4,4′-difluorobenzophenone with a vinyl dialkylsilane. Each R is an independently selected alkyl group. |
| FILED | Monday, January 28, 2008 |
| APPL NO | 12/020623 |
| ART UNIT | 1796 — Organic Chemistry |
| CURRENT CPC | Synthetic resins or natural rubbers 528/127 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772362 | Beall et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Texas State University (San Marcos, Texas) |
| INVENTOR(S) | Gary W. Beall (San Marcos, Texas); Jesse R. Hancock (Austin, Texas); Chad J. Booth (San Marcos, Texas) |
| ABSTRACT | A method of treating an amorphous CBDO polymer to impart self healing and shape memory properties by heat treatment, and products resulting from such method are described. An amorphous CBDO copolymer may include a copolyester prepared by reacting an aromatic dicarboxylic acid or ester or anhydride thereof, a 2,2,4,4-tetraalkyl-1,3-cyclobutanediol and 1,3-propanediol, 1,4-butanediol, or mixture thereof. The method may include heating said copolymer to a temperature above its glass transition temperature to impart self healing and shape memory properties. |
| FILED | Tuesday, July 15, 2008 |
| APPL NO | 12/173186 |
| ART UNIT | 1796 — Organic Chemistry |
| CURRENT CPC | Synthetic resins or natural rubbers 528/502.R00 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772485 | Gaudiana et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Konarka Technologies, Inc. (Lowell, Massachusetts) |
| INVENTOR(S) | Russell Gaudiana (Merrimack, New Hampshire); Richard Kingsborough (North Chelmsford, Massachusetts); David Waller (Lexington, Massachusetts); Zhengguo Zhu (Cambridge, Massachusetts) |
| ABSTRACT | This disclosure relates to a polymer containing a first comonomer repeat unit and a second comonomer repeat unit different from the first comonomer repeat unit. The first comonomer repeat unit includes a cyclopentadithiophene moiety. The polymer can be used as a photoactive material in a photovoltaic cell. This disclosure also relates to such photovoltaic cells, as well as modules containing such photovoltaic cells. |
| FILED | Tuesday, March 14, 2006 |
| APPL NO | 11/375643 |
| ART UNIT | 1795 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Batteries: Thermoelectric and photoelectric 136/252 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772487 | Robinson |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Nanosolar, Inc. (San Jose, California) |
| INVENTOR(S) | Matthew R. Robinson (East Palo Alto, California) |
| ABSTRACT | A photovoltaic apparatus may comprise two or more energy transfer layers and an acceptor layer. The energy transfer layers are configured such that excitons formed by absorption of radiation in one energy transfer layer transfer to an adjacent energy transfer layer that is closer to the acceptor layer by a dipole mechanism without the exciton diffusing to an interface between the two energy transfer layers. This can be achieved by appropriately configuring the HOMO and LUMO (or conduction and valence band) levels of the energy transfer layers and the acceptor layer. |
| FILED | Saturday, October 16, 2004 |
| APPL NO | 10/966338 |
| ART UNIT | 1795 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Batteries: Thermoelectric and photoelectric 136/263 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772579 | Herzog et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Massachusetts Institute of Technology (Cambridge, Massachusetts) |
| INVENTOR(S) | William D. Herzog (Groton, Massachusetts); Antonio Sanchez-Rubio (Lexington, Massachusetts); Gregory G. Cappiello (Windham, New Hampshire); Ronald H. Hoffeld (Cambridge, Massachusetts); Shane M. Tysk (Arlington, Massachusetts); Vincenzo Daneu (Woburn, Massachusetts); Thomas H. Jeys (Lexington, Massachusetts) |
| ABSTRACT | Particle detection systems without knowledge of a location and velocity of a particle passing through a volume of space, are less efficient than if knowledge of the particle location is known. An embodiment of a particle position detection system capable of determining an exact location of a particle in a fluid stream is discussed. The detection system may employ a patterned illuminating beam, such that once a particle passes through the various portions of the patterned illuminating beam, a light scattering is produced. The light scattering defines a temporal profile that contains measurement information indicative of an exact particle location. However, knowledge of the exact particle location has several advantages. These advantages include correction of systematic particle measurement errors due to variability of the particle position within the sample volume, targeting of particles based on position, capture of particles based on position, reduced system energy consumption and reduced system complexity. |
| FILED | Friday, May 18, 2007 |
| APPL NO | 11/804589 |
| ART UNIT | 2878 — Optics |
| CURRENT CPC | Radiant energy 250/574 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772746 | Keolian et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Penn State Research Foundation (University Park, Pennsylvania) |
| INVENTOR(S) | Robert M. Keolian (State College, Pennsylvania); John W. Wuthrich (Albany, New York); Kevin J. Bastyr (Someville, Massachusetts) |
| ABSTRACT | An electroactive transducer converts between acoustical power and electrical power. The transducer includes a diaphragm and a perimeter member. The perimeter member includes at least one electroactive element and is mechanically coupled to the perimeter of the diaphragm such that displacement of the diaphragm stresses the electroactive element. |
| FILED | Tuesday, July 25, 2006 |
| APPL NO | 11/492311 |
| ART UNIT | 2837 — Electrical Circuits and Systems |
| CURRENT CPC | Electrical generator or motor structure 310/339 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773032 | Feria |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Research Foundation of the City University of New York (New York, New York) |
| INVENTOR(S) | Erlan H. Feria (Princeton, New Jersey) |
| ABSTRACT | A method and apparatus for a simplified approach for determining the output of a total covariance signal processor. A single set of offline calculations is performed and then used to estimate the output of the total covariance signal processor. A simplified approach for performing matrix inversion may also be used in determining the output of the total covariance processor. |
| FILED | Thursday, May 10, 2007 |
| APPL NO | 12/299851 |
| ART UNIT | 3662 — Computerized Vehicle Controls and Navigation, Radio Wave, Optical and Acoustic Wave Communication, Robotics, and Nuclear Systems |
| CURRENT CPC | Communications: Directive radio wave systems and devices 342/195 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773043 | Horner et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | Rob Horner (San Diego, California); Rod Cozad (San Diego, California); Hale Simonds (San Diego, California); Robbi Mangra (San Diego, California) |
| ABSTRACT | A Variable Aspect Ratio Tapered Slot Antenna For Increased Directivity And Gain (NC#98102). The apparatus includes a tapered slot antenna having a length and a height, and having an aspect ratio greater than or equal to 2.5. The tapered slot antenna includes a first antenna element comprising conductive material and configured to receive and transmit RF signals; and a second antenna element comprising conductive material, operatively coupled to said first antenna element, configured to receive and transmit RF signals. |
| FILED | Thursday, February 08, 2007 |
| APPL NO | 11/706678 |
| ART UNIT | 2821 — Computerized Vehicle Controls and Navigation, Radio Wave, Optical and Acoustic Wave Communication, Robotics, and Nuclear Systems |
| CURRENT CPC | Communications: Radio wave antennas 343/767 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773064 | Doane et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Kent Displays Incorporated (Kent, Ohio) |
| INVENTOR(S) | J. William Doane (Kent, Ohio); Asad A. Khan (Kent, Ohio); Irina Shiyanovskaya (Stow, Ohio) |
| ABSTRACT | The present invention relates to a display film that may be transferred by lamination or otherwise onto a substrate. The display film is formed of a stack of layers that can include different types, arrangements, and functionality within the stack depending upon factors including the characteristics of the substrate (e.g., upper or lower, transparent or opaque, substrates) and addressing of the display (e.g., active or passive matrix, electrical or optical addressing). The layers of the stacked display film include one or more electrode layers and one or more liquid crystal layers and, in addition, may include various combinations of an adhesive layer, preparation layer, casting layer, light absorbing layer, insulation layers, and protective layers. The liquid crystal layer can include cholesteric or other liquid crystal material. The liquid crystal layer can be a dispersion of liquid crystal in a polymer matrix formed by a variety of techniques. The display film may interact with components mounted on or laminated to the substrate, including a solar cell, active matrix backplane and electrodes. The display film may be mounted onto flexible or drapable substrates such as fabric and can itself be drapable. Thus, the invention offers substantial flexibility in fabrication and design that has not been previously possible in the display industry. |
| FILED | Friday, January 28, 2005 |
| APPL NO | 10/587548 |
| ART UNIT | 2629 — Computerized Vehicle Controls and Navigation, Radio Wave, Optical and Acoustic Wave Communication, Robotics, and Nuclear Systems |
| CURRENT CPC | Computer graphics processing and selective visual display systems 345/87 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773111 | Cleveland et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | LC Technologies, Inc. (Fairfax, Virginia) |
| INVENTOR(S) | Dixon Cleveland (Annandale, Virginia); Arthur W. Joyce, III (Vienna, Virginia) |
| ABSTRACT | An embodiment of the present invention provide a system for measuring and modifying at least one model parameter of an object of an image in order to distinguish the object from noise in the image includes a perceived image generator, an image-match function, and a parameter adjustment function. The perceived image generator produces a first perceived image of the object based on the at least one model parameter. The image-match function compares the first perceived image with a real image of the object. The parameter adjustment function adjusts the at least one model parameter so that the perceived image generator produces a second perceived image of the object that more closely matches the real image than the first perceived image. |
| FILED | Wednesday, March 15, 2006 |
| APPL NO | 11/375041 |
| ART UNIT | 2621 — Selective Visual Display Systems |
| CURRENT CPC | Television 348/135 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773204 | Nelson |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | United States of America as represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | Robert Sigurd Nelson (San Diego, California) |
| ABSTRACT | Spatial encoding of a search space is achieved by an array of radiation or acoustic energy detectors receiving data from at least one radiation or energy source. At least one radiation source capable of providing a predetermined type of radiation is used. The radiation may be in the form of a plurality of beams arrayed along at least one directional axis, and arranged in successive alignment to exhibit a directional component. The directional component is characterized by a frequency variance between successive beams in accordance with direction and disposed so radiation therefrom propagates within the search space. At least one radiation detector capable of detecting the radiation is provided, and is disposed to detect at least that type of radiation. |
| FILED | Thursday, February 28, 2008 |
| APPL NO | 12/039531 |
| ART UNIT | 3662 — Computerized Vehicle Controls and Navigation, Radio Wave, Optical and Acoustic Wave Communication, Robotics, and Nuclear Systems |
| CURRENT CPC | Optics: Measuring and testing 356/5.20 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773219 | Czege et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Air Force (Wright-Patterson Air Force Base, Ohio) |
| INVENTOR(S) | Jozsef Czege (Highland, Maryland); Burt V. Bronk (Abington, Maryland) |
| ABSTRACT | A method and apparatus for measuring Mueller matrix parameters from scattered light. The apparatus is advantageous for use in countering bioterrorism by detecting information concerning airborne pathogens, particularly microorganism in aerosol form. The system provided is portable, more efficient, and less sensitive to wavelength changes. The method uses variation in retardation over wavelength as opposed to variation in retardation with time. |
| FILED | Monday, March 31, 2008 |
| APPL NO | 12/082195 |
| ART UNIT | 2877 — Optics |
| CURRENT CPC | Optics: Measuring and testing 356/364 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773229 | Harlander et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | John M Harlander (St. Cloud, Minnesota); Christoph R Englert (Alexandria, Virginia) |
| ABSTRACT | A Doppler Asymmetric Spatial Heterodyne (DASH) spectrometer includes an input aperture for receiving an input light; a collimating lens for collimating the input light into a collimated light; offset establishing means, including at least one grating, for i) receiving and splitting the collimated light into a first light wavefront in a first optical path and into a second light wavefront in a second optical path, ii) establishing an offset in a light wavefront path distance between the first and second optical path light wavefronts, and iii) diffracting and recombining the first and second optical path light wavefronts into an interference wavefront to form an interference image that includes a plurality of phase points of a heterodyned interferogram measured simultaneously over the path distance offset; and an output optics section comprising a detector for receiving the interference image and outputting an interference image pattern. |
| FILED | Friday, July 25, 2008 |
| APPL NO | 12/179720 |
| ART UNIT | 2886 — Optics |
| CURRENT CPC | Optics: Measuring and testing 356/451 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773363 | Pelrine et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | SRI International (Menlo Park, California) |
| INVENTOR(S) | Ronald E. Pelrine (Longmont, Colorado); Harsha Prahlad (Cupertino, California); Joseph S. Eckerle (Redwood City, California); Roy D. Kornbluh (Palo Alto, California); Scott Stanford (Mountain View, California) |
| ABSTRACT | Described herein is electroadhesion technology that permits controllable adherence between two objects. Electroadhesion uses electrostatic forces of attraction produced by an electrostatic adhesion voltage, which is applied using electrodes in an electroadhesive device. The electrostatic adhesion voltage produces an electric field and electrostatic adherence forces. When the electroadhesive device and electrodes are positioned near a surface of an object such as a vertical wall, the electrostatic adherence forces hold the electroadhesive device in position relative to the surface and object. This can be used to increase traction or maintain the position of the electroadhesive device relative to a surface. Electric control of the electrostatic adhesion voltage permits the adhesion to be controllably and readily turned on and off. |
| FILED | Monday, July 30, 2007 |
| APPL NO | 11/830814 |
| ART UNIT | 2836 — Electrical Circuits and Systems |
| CURRENT CPC | Electricity: Electrical systems and devices 361/234 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773395 | Siri |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Aerospace Corporation (El Segundo, California) |
| INVENTOR(S) | Kasemsan Siri (Torrance, California) |
| ABSTRACT | A uniform converter input voltage distribution power system evenly controls the individual input voltages of DC-to-DC series-input parallel-output connected converters using a uniform input voltage distribution controller including a generator for generating respective error signals from the converter input voltages using a common distribution reference signal for providing respective converter control signals connected to the converters through respective shared-bus controls for evenly distributing the power delivered by the converters that are shared-bus current-mode converters for preferably providing a low output voltage. Employing a common regulation control signal, the controller can also provide system output voltage regulation, system input current limiting, proportional-voltage control, relaxed voltage uniformity, and fault-tolerant power control. |
| FILED | Wednesday, February 21, 2007 |
| APPL NO | 11/713826 |
| ART UNIT | 2838 — Electrical Circuits and Systems |
| CURRENT CPC | Electric power conversion systems 363/65 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773885 | Weaver |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Boeing Company (Chicago, Illinois) |
| INVENTOR(S) | Thomas L Weaver (Webster, Missouri) |
| ABSTRACT | A system and method for detecting and correcting for thermal shifting of the passbands of an input filter of an optical receiver relative to the passbands of an output of an optical device, such as an optical router, where the router and the receiver are operating at remote locations and at different operating temperatures that cause thermal drifting of the passbands. In one implementation RF signals are impressed on optical signals transmitted by a transmitter to the optical router. Different frequency RF signals are impressed on each of the optical signals and the receiver uses the detected RF frequencies to cancel portions of optical signals that have drifted into adjacent passbands at the optical receiver. In another implementation a mechanically adjustable filter is employed at the receiver which is used to achieve a needed degree of shifting of the receiver passbands to compensate for passband misalignment between the router and the receiver. In another implementation multiple receive channels are employed for each router passband. The various described implementations allow for detecting and correcting of thermal misalignment between the router and receiver passband without the need for controlling the temperature of the router. |
| FILED | Tuesday, August 09, 2005 |
| APPL NO | 11/200295 |
| ART UNIT | 2613 — Computer Graphic Processing, 3D Animation, Display Color Attribute, Object Processing, Hardware and Memory |
| CURRENT CPC | Optical communications 398/95 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07774197 | Bulyko |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Raytheon BBN Technologies Corp. (Cambridge, Massachusetts) |
| INVENTOR(S) | Ivan Ivanovich Bulyko (Cambridge, Massachusetts) |
| ABSTRACT | Methods for building arbitrarily large language models are presented herein. The methods provide a scalable solution to estimating a language model using a large data set by breaking the language model estimation process into sub-processes and parallelizing computation of various portions of the process. |
| FILED | Wednesday, September 27, 2006 |
| APPL NO | 11/529663 |
| ART UNIT | 2626 — Selective Visual Display Systems |
| CURRENT CPC | Data processing: Speech signal processing, linguistics, language translation, and audio compression/decompression 74/9 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07774297 | VanRiper et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Honeywell International Inc. (Morristown, New Jersey) |
| INVENTOR(S) | Ryan A. VanRiper (Maple Grove, Minnesota); David Musliner (Plymouth, Minnesota); Christopher W. Geib (Minneapolis, Minnesota) |
| ABSTRACT | A system and method analyzes queries in a computer network, and identifies problem-causing queries that could be harmful to the system. If a query does not match any queries in a database, the query is transmitted to its destination. If a query matches a query in the database, that query is blocked from transmission to the destination. If a query is transmitted to its destination, and it is later determined that query caused a problem on that destination, that query is added to the database of queries. In one embodiment, a query that does not cause any problems is written to a pool of current up-to-date backup databases that may be used if the main system goes down. In another embodiment, the system tests variants of a query that caused a problem at the destination to attempt to discover other queries that could cause a problem. |
| FILED | Friday, December 30, 2005 |
| APPL NO | 11/323313 |
| ART UNIT | 2162 — Data Bases & File Management |
| CURRENT CPC | Data processing: Database and file management or data structures 77/204 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07774554 | Chaudhary et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | International Business Machines Corporation (Armonk, New York) |
| INVENTOR(S) | Piyush Chaudhary (Highland, New York); Rama K. Govindaraju (Hopewell Junction, New York); Jay Robert Herring (Hyde Park, New York); Peter Hochschild (New Yor., New York); Chulho Kim (Poughkeepsie, New York); Rajeev Sivaram (West Orange, New Jersey); Hanhong Xue (Poughkeepsie, New York) |
| ABSTRACT | A system and method to provide injection of important data directly into a processor's cache location when that processor has previously indicated interest in the data. The memory subsystem at a target processor will determine if the memory address of data to be written to a memory location associated with the target processor is found in a processor cache of the target processor. If it is determined that the memory address is found in a target processor's cache, the data will be directly written to that cache at the same time that the data is being provided to a location in main memory. |
| FILED | Tuesday, February 20, 2007 |
| APPL NO | 11/676745 |
| ART UNIT | 2185 — Computer Architecture and I/O |
| CURRENT CPC | Electrical computers and digital processing systems: Memory 711/142 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07774654 | Bose et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | International Business Machines Corporation (Armonk, New York) |
| INVENTOR(S) | Pradip Bose (Yorktown Heights, New York); Jude A. Rivers (Cortlandt Manor, New York); Balaram Sinharoy (Poughkeepsie, New York); Victor Zyuban (Yorktown Heights, New York) |
| ABSTRACT | A computer implemented method, apparatus, and computer usable program code for preventing soft error accumulation. A number of cycles between references to a register are counted. Instructions are injected that reference the register for preventing soft error accumulation in response to a determination that the number of cycles is greater than a threshold. |
| FILED | Thursday, March 20, 2008 |
| APPL NO | 12/051904 |
| ART UNIT | 2113 — Computer Error Control, Reliability, & Control Systems |
| CURRENT CPC | Error detection/correction and fault detection/recovery 714/38 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07774725 | Jain et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Purdue Research Foundation (West Lafayette, Indiana) |
| INVENTOR(S) | Jitesh Jain (Rajasthan, India); Stephen F. Cauley (West Lafayette, Indiana); Hong Li (He nan, China PRC); Cheng-Kok Koh (West Lafayette, Indiana); Venkataramanan Balakrishnan (West Lafayette, Indiana) |
| ABSTRACT | A method of simulating operation of a VLSI interconnect structure having capacitive and inductive coupling between nodes thereof. A matrix X and a matrix Y containing different combinations of passive circuit element values for the interconnect structure are obtained where the element values for each matrix include inductance L and inverse capacitance P. An adjacency matrix A associated with the interconnect structure is obtained. Numerical integration is used to solve first and second equations, each including as a factor the product of the inverse matrix X1 and at least one other matrix, with first equation including X1Y, X1A, and X1P, and the second equation including X1A and X1P. |
| FILED | Monday, November 06, 2006 |
| APPL NO | 11/593465 |
| ART UNIT | 2825 — Semiconductors/Memory |
| CURRENT CPC | Computer-aided design and analysis of circuits and semiconductor masks 716/4 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Health and Human Services (HHS)
| US 07771356 | Voie et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Spentech, Inc. (Seattle, Washington) |
| INVENTOR(S) | Arne H. Voie (Seattle, Washington); Mark A. Moehring (Seattle, Washington); George A. Gates (Woodway, Washington); Eugene A. Saxon (Seattle, Washington); Mailee J. Hess (Portland, Oregon) |
| ABSTRACT | A system and method for examining a patient for an ear disorder. Reflectance ultrasound is applied to a portion of the ear to determine the presence of ear effusion in a middle ear. If ear effusion is present, motion of the tympanic membrane is induced and ultrasound is further applied to the moving tympanic membrane. Echo signals resulting from the ultrasound applied to the moving tympanic membrane are analyzed to obtain information regarding the motion of the tympanic membrane and is used to characterize the ear effusion. |
| FILED | Monday, November 14, 2005 |
| APPL NO | 11/274729 |
| ART UNIT | 3737 — Electrical Circuits and Systems |
| CURRENT CPC | Surgery 6/438 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771715 | Schlom et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Jeffrey Schlom (Potomac, Maryland); James Hodge (Gaithersburg, Maryland); Dennis Panicali (Acton, Massachusetts) |
| ABSTRACT | The present invention is a recombinant vector encoding and expressing at least three or more costimulatory molecules. The recombinant vector may additionally contain a gene encoding one or more target antigens or immunological epitope thereof. The synergistic effect of these costimulatory molecules on the enhanced activation of T cells is demonstrated. The degree of T-cell activation using recombinant vectors containing genes encoding three costimulatory molecules was far greater than the sum of recombinant vector constructs containing one costimulatory molecule and greater than the use of two costimulatory molecules. Results employing the triple costimulatory vectors were most dramatic under conditions of either low levels of first signal or low stimulator to T-cell ratios. This phenomenon was observed with both isolated CD4+ and CD8+ T cells. The recombinant vectors of the present invention are useful as immunogenes and vaccines against cancer and pathogenic micro-organisms, and in providing host cells, including dendritic cells and splenocytes with enhanced antigen-presenting functions. |
| FILED | Wednesday, March 21, 2007 |
| APPL NO | 11/723666 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/93.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771718 | Spies et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Fred Hutchinson Cancer Research Center (Seattle, Washington) |
| INVENTOR(S) | Thomas Spies (Seattle, Washington); Veronika Spies (Seattle, Washington) |
| ABSTRACT | The present invention provides prognostic and diagnostic methods for cancer, as well as methods for monitoring or staging cancer. Methods involve assaying for tumor-derived soluble MIC polypeptide—either MICA or MICB or both—in a sample from a subject. Assays can be implemented with a MIC polypeptide binding agent such as a MIC polypeptide antibody or recombinant NKG2D. An ELISA sandwich assay is employed in some embodiments of the invention to identify a soluble MIC polypeptide. In additional embodiments, a sample is assayed for tumor cell-surface bound MIC in addition to assaying for soluble MIC. The invention also provides methods of cancer therapy involving detecting cancer in the subject by assaying for soluble MIC polypeptide and then administering a cancer therapy. |
| FILED | Tuesday, April 22, 2003 |
| APPL NO | 10/512181 |
| ART UNIT | 1642 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/130.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771726 | Tsuji et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | New York University (New York, New York); The Research Foundation of the City University of New York (New York, New York); Aaron Diamond Aids Research Center (New York, New York) |
| INVENTOR(S) | Moriya Tsuji (New York, New York); John Schmieg (New York, New York); Richard Franck (Riverside, Connecticut); Yaoxing Huang (Brooklyn, New York) |
| ABSTRACT | The present invention relates to methods and compositions for augmenting an immunogenicity of an antigen in a mammal, comprising administering said antigen together with an adjuvant composition that includes a synthetic glycolipid compound of Formula I, as described herein. According to the present invention, the use of a compound of Formula I as an adjuvant is attributed at least in part to the enhancement and/or extension of antigen-specific Th1-type responses, in particular, CD8+ T cell responses. The methods and compositions of the present invention can be useful for prophylaxis and treatment of various infectious and neoplastic diseases. |
| FILED | Friday, October 08, 2004 |
| APPL NO | 10/962374 |
| ART UNIT | 1643 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/184.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771729 | Franchini et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Genoveffa Franchini (Washington, District of Columbia); Zdenek Hel (Rockville, Maryland); George Pavlakis (Rockville, Maryland); James Tartaglia (Aurora, Canada) |
| ABSTRACT | This invention relates to improved methods of inducing an immune response for the prevention or treatment of HIV-1 infection by using a nucleic acid vaccine in conjunction with a recombinant viral vaccine, e.g., a poxvirus vaccine, to potentiate and broaden the immune response. The present invention further provides a particularly effective vaccine regimen comprising a DNA vaccine used in combination with a poxvirus virus, especially NYVAC or ALVAC. |
| FILED | Wednesday, July 05, 2006 |
| APPL NO | 11/428815 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/199.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771730 | Nguyen et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Novartis Vaccines and Diagnostics, Inc. (Emeryville, California) |
| INVENTOR(S) | Steve H. Nguyen (Oakland, California); Sergio Pichuantes (El Cerrito, California) |
| ABSTRACT | Novel methods and immunodiagnostic test kits for the detection of hantavirus infection are disclosed. The methods and kits employ combinations of recombinant N and/or G1 antigens from at least six different hantavirus serotypes, including Hantaan (HTNV), Puumala (PUUV), Seoul (SEOV), Dobrava (DOBV), Sin Nombre (SNV) and Andes (ANDV). Additional hantavirus antigens from these and other hantavirus types may also be present. The methods provide for highly accurate results and allow the detection of infection so that treatment can be administered and death avoided. |
| FILED | Tuesday, May 24, 2005 |
| APPL NO | 11/629799 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/202.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771732 | Peppas et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Board of Regents, The University of Texas System (Austin, Texas) |
| INVENTOR(S) | Nicholas A. Peppas (Austin, Texas); James Z. Hilt (Lexington, Kentucky); Mark E. Byrne (Auburn, Alabama) |
| ABSTRACT | Biomimetic polymer networks comprising a heteropolymer network having a cavity, the cavity having a selective affinity for a moiety, methods for making biomimetic polymer networks, and methods for using biomimetic polymer networks. |
| FILED | Friday, April 28, 2006 |
| APPL NO | 11/380803 |
| ART UNIT | 1618 — Organic Compounds: Bio-affecting, Body Treating, Drug Delivery, Steroids, Herbicides, Pesticides, Cosmetics, and Drugs |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/400 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771942 | Burmester |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Marshfield Clinic (Marshfield, Wisconsin) |
| INVENTOR(S) | James K. Burmester (Marshfield, Wisconsin) |
| ABSTRACT | The invention provides a method for determining a genetic predisposition to prostate cancer in a male human subject. In one aspect, the method comprises determining whether the subject has the genotype GG of refSNP rs125555, where the genotype GG of refSNP rs125555 indicates that the subject is genetically predisposed to prostate cancer. |
| FILED | Wednesday, July 25, 2007 |
| APPL NO | 11/828155 |
| ART UNIT | 1634 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/6 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771944 | Xiao et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Board of Trustees of the University of Illinois (Urbana, Illinois); Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Ming Xiao (Huntingdo Valley, Pennsylvania); Pui-Yan Kwok (San Francisco, California); Paul Selvin (Urbana, Illinois); Mathew Gordon (Palo Alto, California) |
| ABSTRACT | Improved methods of genetic haplotyping and DNA sequencing and mapping, including methods for making amplified ssDNA, methods for allele determination, and a DNA barcoding strategy based on direct imaging of individual DNA molecules and localization of multiple sequence motifs or polymorphic sites on a single DNA molecule. |
| FILED | Friday, December 14, 2007 |
| APPL NO | 11/957216 |
| ART UNIT | 1637 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/6 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771954 | Hazen et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Cleveland Clinic Foundation (Cleveland, Ohio) |
| INVENTOR(S) | Stanley L. Hazen (Pepper Pike, Ohio); Zeneng Wang (Cleveland, Ohio) |
| ABSTRACT | A diagnostic method of monitoring anti-inflammatory and/or antioxidant actions of therapeutic agents comprises determining the level of at least one systemic marker indicative of inflammation or oxidation in a bodily sample taken from a subject at base line or following administration of the therapeutic agent. The marker includes at least one of MPO activity, MPO mass, select MPO-generated oxidation products, and combinations thereof. The level of the systemic marker is compared with a predetermined value to monitor the anti-inflammatory and/or antioxidant actions of the therapeutic agent. |
| FILED | Wednesday, April 26, 2006 |
| APPL NO | 11/412065 |
| ART UNIT | 1644 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/7.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771956 | Gilbert et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Brigham and Women's Hospital, Inc. (Boston, Massachusetts); United States of America Department of Veterans Affairs (Washington, District of Columbia) |
| INVENTOR(S) | Gary E. Gilbert (Winchester, Massachusetts); Jialan Shi (Newton, Massachusetts); Christian W. Heegaard (Egaa, Denmark); Jan T. Rasmussen (Ry, Denmark) |
| ABSTRACT | A method, kit and probe for detecting the presence of a phospholipid, such as phosphatidylserine, in a biological material is provided. A binding agent including lactadherin, a fragment of lactadherin, a functional equivalent of lactadherin, or a functional equivalent of a fragment of lactadherin, is used to detect the presence of any phospholipid. |
| FILED | Wednesday, June 30, 2004 |
| APPL NO | 10/562269 |
| ART UNIT | 1657 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/7.200 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771993 | Stedman et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Trustees of the University of Pennsylvania (Philadelphia, Pennsylvania) |
| INVENTOR(S) | Hansell H. Stedman (Norristown, Pennsylvania); Leonard T. Su (Seattle, Washington); Marilyn A. Mitchell (Philadelphia, Pennsylvania) |
| ABSTRACT | A microutrophin containing a utrophin having internal deletions (relative to a native utrophin) in the hinge regions and a C-terminal deletion is provided. Also provided are vectors and compositions useful for delivering the microutrophin for the treatment of muscular disorders, including Duchenne Muscular Dystrophy. |
| FILED | Friday, January 21, 2005 |
| APPL NO | 10/586890 |
| ART UNIT | 1656 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/320.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772159 | Smith, III et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Trustees of the University of Pennsylvania (Philadelphia, Pennsylvania) |
| INVENTOR(S) | Amos B. Smith, III (Merion, Pennsylvania); Hu Liu (Quincy, Massachusetts); Hiroyuki Ikumura (Osaka, Japan); Ralph F. Hirschmann (Pasedena, California) |
| ABSTRACT | The invention provides a new process for the preparation of polypyrrolinones (I) of various sizes which have found to be useful peptidomimetics. One aspect of the invention is a new process utilizing α-amino-α-substituted-valerolactones as synthons. A second aspect of the invention is a process for the synthesis of polypyrrolinones using solid-phase techniques. |
| FILED | Tuesday, July 20, 2004 |
| APPL NO | 10/894916 |
| ART UNIT | 1639 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Combinatorial chemistry technology: Method, library, apparatus 56/30 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772185 | English et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Emory University (Atlanta, Georgia) |
| INVENTOR(S) | Arthur W. English (Atlanta, Georgia); Robert McKeon (Atlanta, Georgia); Erica Werner (Decatur, Georgia) |
| ABSTRACT | The subject invention pertains to the therapeutic use of certain GAG-degrading enzymes, and enzyme combinations, to promote nerve repair and regeneration. |
| FILED | Monday, January 31, 2005 |
| APPL NO | 11/051996 |
| ART UNIT | 1649 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/12 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772192 | Esko |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Jeffrey D. Esko (San Diego, California) |
| ABSTRACT | Compositions and methods for treatment of disease with acetylated disaccharides and analogs thereof are provided. |
| FILED | Tuesday, June 01, 2004 |
| APPL NO | 10/559260 |
| ART UNIT | 1623 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/25 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772201 | Mixson |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | “University of Maryland, Baltimore” (Baltimore, Maryland) |
| INVENTOR(S) | Archibald Mixson (Rockville, Maryland) |
| ABSTRACT | The present invention is directed to methods of transfecting cells with siRNA, by contacting a transfection complex with one or more cells, where the transfection complex includes a transport polymer and siRNA. The transport polymer may include for example, H3K8b and/or structurally similar compounds. The invention is also directed to such transfection complexes, and to compositions that include such transfection complexes. The invention is further directed to methods of treating patients using the transfection complexes of the present invention. |
| FILED | Thursday, November 17, 2005 |
| APPL NO | 11/718342 |
| ART UNIT | 1635 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/44 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772202 | Dangsheng et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | New York University (New York, New York) |
| INVENTOR(S) | Li Dangsheng (Forest Hills, New York); Sharmistha Das (Seaucus, New Jersey); Herbert Samuels (New Rochelle, New York) |
| ABSTRACT | Disclosed herein is the discovery that administration of the NRIF3 family of transcriptional coregulators (NRIF3 and related molecules) to breast cancer cells induce rapid and profound apoptosis (nearly 100% cell death within 24 h). A novel death domain (DD1) was mapped to a short 30 amino acid region common to all members of the NRIF3 family. Two other death domains (DD2 and DD3) were also found to have effective breast cancer killing activities. Mechanistic studies showed that DD1-induced apoptosis occurred through a novel caspase-2 mediated pathway that involved mitochondria membrane permeabilization but did not require other caspases. Interestingly, cytotoxicity of NRIF3 related molecules was cell-type specific, as they selectively killed breast cancer or related cells but not other examined cells of different origins, suggesting the presence in breast cancer cells of a specific death switch that can be selectively triggered by NRIF3 and related molecules. Also disclosed are strategies utilizing NRIF3 related molecules and/or targeting this death switch for the development of novel and more selective therapeutics against breast cancer. |
| FILED | Tuesday, August 07, 2007 |
| APPL NO | 11/834853 |
| ART UNIT | 1642 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/44 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772203 | Zamore et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Massachusetts (Boston, Massachusetts) |
| INVENTOR(S) | Phillip D. Zamore (Northboro, Massachusetts); Guiliang Tang (Worcester, Massachusetts) |
| ABSTRACT | Based at least in part on an understanding of the mechanisms by which small RNAs (e.g., naturally-occurring miRNAs) mediate RNA silencing in plants, rules have been established for determining, for example, the degree of complementarity required between an RNAi-mediating agent and its target, i.e., whether mismatches are tolerated, the number of mismatches tolerated, the effect of the position of the mismatches, etc. Such rules are useful, in particular, in the design of improved RNAi-mediating agents which allow for more exact control of the efficacy of RNA silencing. |
| FILED | Monday, July 14, 2008 |
| APPL NO | 12/172938 |
| ART UNIT | 1635 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/44 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772271 | Karp et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | PTC Therapeutics, Inc. (South Plainfield, New Jersey) |
| INVENTOR(S) | Gary Mitchell Karp (Princeton Junction, New Jersey); Peter Seongwoo Hwang (Edison, New Jersey); James J. Takasugi (Lawrenceville, New Jersey); Hongyu Ren (Dayton, New Jersey); Richard Gerald Wilde (Somerville, New Jersey); Anthony Turpoff (Edison, New Jersey); Alexander Arefolov (Newton, Massachusetts); Guangming Chen (Bridgewater, New Jersey); Jeffrey Allen Campbell (Bethlehem, Pennsylvania); Chunshi Li (East Brunswick, New Jersey); Steven Paget (Hillsborough, New Jersey); Nanjing Zhang (Princeton, New Jersey); Xiaoyan Zhang (Belle Mead, New Jersey); Jin Zhu (Raritan, New Jersey) |
| ABSTRACT | The present invention provides compounds, pharmaceutical compositions, and methods of using such compounds or compositions for treating infection by a virus, or for affecting viral IRES activity. |
| FILED | Tuesday, January 16, 2007 |
| APPL NO | 11/653448 |
| ART UNIT | 1624 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/415 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772380 | Porcelli |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Albert Einstein College of Medicine of Yeshiva University (Bronx, New York) |
| INVENTOR(S) | Steven A. Porcelli (Bronx, New York) |
| ABSTRACT | α-Galactosylceramides and glycosylceramides (“ceramide-like glycolipids”) that modulate NK T cells. The ceramide-like glycolipids vary in the cytokines induced in NK T cells and vary in the antigen-presenting cells that are capable of efficiently presenting the compounds to NK T cells. Pharmaceutical compositions of the ceramide-like glycolipids are provided, as are pharmaceutical compositions of the ceramide-like glycolipids combined with dendritic cells. Methods utilizing the ceramide-like glycolipids in vaccines, to activate NK T cells, to stimulate the immune system, and to treat mammals are also provided. The invention also provides methods of evaluating a compound for its ability to activate an NK T cell in the presence of a cell expressing a CD1d protein. |
| FILED | Friday, August 26, 2005 |
| APPL NO | 11/211653 |
| ART UNIT | 1623 — Organic Chemistry |
| CURRENT CPC | Organic compounds 536/17.900 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772383 | Chakrabarti et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Trustees of Princeton University (Princeton, New Jersey) |
| INVENTOR(S) | Raj Chakrabarti (New York, New York); Clarence Schutt (Princeton, New Jersey) |
| ABSTRACT | A composition for performing a polynucleotide amplification reaction at low temperature, including a polynucleotide amplification reaction mixture into which is incorporated a sufficiently high concentration of a low molecular weight compound selected from the group consisting of amides, sulfones, sulfoxides and diols, to accomplish the amplification at the low temperature. In another embodiment, a composition for enhancing a polynucleotide amplification reaction, including a polynucleotide amplification reaction mixture into which is incorporated a low molecular weight diol in an amount effective to enhance the polynucleotide amplification. |
| FILED | Wednesday, March 03, 2004 |
| APPL NO | 10/792404 |
| ART UNIT | 1637 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Organic compounds 536/22.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772389 | Tuschl et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Rockefeller University (New York, New York) |
| INVENTOR(S) | Thomas Tuschl (New York, New York); Markus Landthaler (New York, New York); Gunter Meister (New York, New York); Sebastien Pfeffer (Strasbourg, France) |
| ABSTRACT | The invention relates to isolated anti-microRNA molecules. In another embodiment, the invention relates to an isolated microRNA molecule. In yet another embodiment, the invention provides a method for inhibiting microRNP activity in a cell. |
| FILED | Friday, February 11, 2005 |
| APPL NO | 10/589449 |
| ART UNIT | 1635 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Organic compounds 536/24.500 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772433 | Dalton et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Tennessee Research Foundation (Knoxville, Tennessee) |
| INVENTOR(S) | James T. Dalton (Upper Arlington, Ohio); Duane D. Miller (Germantown, Tennessee) |
| ABSTRACT | This invention provides SARM compounds and uses thereof in treating a variety of diseases or conditions in a subject, including, inter-alia, muscle wasting diseases and/or disorders, bone-related diseases and/or disorders, diabetes, cardiovascular disease, renal disease and others. |
| FILED | Monday, April 16, 2007 |
| APPL NO | 11/785250 |
| ART UNIT | 1621 — Organic Chemistry |
| CURRENT CPC | Organic compounds 564/175 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772458 | Boucher, Jr. et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The University of North Carolina at Chapel Hill (Chapel Hill, North Carolina) |
| INVENTOR(S) | Richard C. Boucher, Jr. (Chapel Hill, North Carolina); Wanda O'Neal (Cary, North Carolina); Barbara Grubb (Hillsborough, North Carolina); Marcus Mall (Chapel Hill, North Carolina) |
| ABSTRACT | A nonhuman transgenic mammal is described whose genome comprises a promoter construct operably linked to a heterologous DNA encoding an epithelial sodium channel β subunit, wherein said promoter construct directs expression of the epithelial sodium channel β subunit in lung epithelial cells of said animal, and wherein said transgenic mammal has increased lung mucus retention as compared to the corresponding wild-type mammal. The animal is useful in screening compounds for activity in treating lung diseases such as cystic fibrosis and chronic obstructive pulmonary disease. |
| FILED | Friday, September 19, 2008 |
| APPL NO | 12/233869 |
| ART UNIT | 1632 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Multicellular living organisms and unmodified parts thereof and related processes 8/3 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07774053 | Garell et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Wisconsin Alumni Research Foundation (Madison, Wisconsin) |
| INVENTOR(S) | P. Charles Garell (Madison, Wisconsin); Justin C. Williams (Madison, Wisconsin) |
| ABSTRACT | A neural probe array is provided for subdural implantation to record intracranial field potentials in the brain. The neural probe array includes a base having first and second sides and a plurality of apertures therebetween. A plurality of contacts are spaced along the first side of the base for recording the field potentials. It is contemplated to provide drug delivery through the apertures in the base in order to enhance the biocompatibility of the neural probe array and to utilize the field potentials recorded by the contacts to drive an external device. |
| FILED | Thursday, March 31, 2005 |
| APPL NO | 11/095363 |
| ART UNIT | 3736 — Sheet Container Making, Package Making, Receptacles, Shoes, Apparel, and Tool Driving or Impacting |
| CURRENT CPC | Surgery 6/544 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07774143 | Khan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary, Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Javed Khan (Derwood, Maryland); Markus Ringnér (Lund, Sweden); Carsten Peterson (Lund, Sweden); Paul Meltzer (Rockville, Maryland) |
| ABSTRACT | A method of diagnosing, predicting, or prognosticating about a disease that includes obtaining experimental data, wherein the experimental data is high dimensional data, filtering the data, reducing the dimensionality of the data through use of one or more methods, training a supervised pattern recognition method, ranking individual data points from the data, wherein the ranking is dependent on the outcome of the supervised pattern recognition method, choosing multiple data points from the data, wherein the choice is based on the relative ranking of the individual data points, and using the multiple data points to determine if an unknown set of experimental data indicates a diseased condition, a predilection for a diseased condition, or a prognosis about a diseased condition. |
| FILED | Thursday, April 25, 2002 |
| APPL NO | 10/133937 |
| ART UNIT | 1631 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Data processing: Measuring, calibrating, or testing 72/19 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Energy (DOE)
| US 07770386 | Lowe et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Caterpillar Inc (Peoria, Illinois) |
| INVENTOR(S) | Michael D. Lowe (Metamora, Illinois); Wade J. Robel (Normale, Illinois); Maarten Verkiel (Metamora, Illinois); James J. Driscoll (Dunlap, Illinois) |
| ABSTRACT | A method of removing sulfur from a filter system of an engine includes continuously passing an exhaust flow through a desulfation leg of the filter system during desulfation. The method also includes sensing at least one characteristic of the exhaust flow and modifying a flow rate of the exhaust flow during desulfation in response to the sensing. |
| FILED | Tuesday, December 28, 2004 |
| APPL NO | 11/022692 |
| ART UNIT | 3748 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Power plants 060/295 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07770898 | Dietle et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Kalsi Engineering, Inc. (Sugar Land, Texas) |
| INVENTOR(S) | Lannie L. Dietle (Houston, Texas); John E. Schroeder (Richmond, Texas) |
| ABSTRACT | A hydrodynamic sealing assembly including a first component having first and second walls and a peripheral wall defining a seal groove, a second component having a rotatable surface relative to said first component, and a hydrodynamic seal comprising a seal body of generally ring-shaped configuration having a circumference. The seal body includes hydrodynamic and static sealing lips each having a cross-sectional area that substantially vary in time with each other about the circumference. In an uninstalled condition, the seal body has a length defined between first and second seal body ends which varies in time with the hydrodynamic sealing lip cross-sectional area. The first and second ends generally face the first and second walls, respectively. In the uninstalled condition, the first end is angulated relative to the first wall and the second end is angulated relative to the second wall. The seal body has a twist-limiting surface adjacent the static sealing lip. In the uninstalled condition, the twist-limiting surface is angulated relative to the peripheral wall and varies along the circumference. A seal body discontinuity and a first component discontinuity mate to prevent rotation of the seal body relative to the first component. |
| FILED | Thursday, January 04, 2007 |
| APPL NO | 11/649693 |
| ART UNIT | 3676 — Wells, Earth Boring/Moving/Working, Excavating, Mining, Harvesters, Bridges, Roads, Petroleum, Closures, Connections, and Hardware |
| CURRENT CPC | Seal for a joint or juncture 277/559 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771496 | Nakahara et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Quallion LLC (Sylmar, California) |
| INVENTOR(S) | Hiroshi Nakahara (Santa Clarita, California); Sang Young Yoon (Saugus, California) |
| ABSTRACT | A method of a reducing impurities in an electrolyte includes contacting one or more components of an electrolyte with a zeolite. The method also includes activating one or more anode and one or more cathodes with the electrolyte. Contacting the one or more components with the zeolite can include contacting the electrolyte with the zeolite. In some instances, the method includes preparing the electrolyte after contacting the one or more components of the electrolyte with the zeolite. |
| FILED | Tuesday, February 08, 2005 |
| APPL NO | 11/053338 |
| ART UNIT | 1795 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Metal working 029/623.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771519 | Carolan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Air Products and Chemicals, Inc. (Allentown, Pennsylvania) |
| INVENTOR(S) | Michael Francis Carolan (Allentown, Pennsylvania); Christopher Francis Miller (Macungie, Pennsylvania) |
| ABSTRACT | Ion transport membrane system comprising (a) a pressure vessel comprising an interior, an exterior, an inlet, an inlet conduit, an outlet, and an outlet conduit; (b) a plurality of planar ion transport membrane modules disposed in the interior of the pressure vessel and arranged in series, each membrane module comprising mixed metal oxide ceramic material and having an interior region and an exterior region, wherein the inlet and the outlet of the pressure vessel are in flow communication with exterior regions of the membrane modules; (c) a gas manifold having an interior surface wherein the gas manifold is in flow communication with the interior region of each of the planar ion transport membrane modules and with the exterior of the pressure vessel; and (d) a liner disposed within any of the inlet conduit, the outlet conduit, and the interior surface of the gas manifold. |
| FILED | Tuesday, August 14, 2007 |
| APPL NO | 11/838477 |
| ART UNIT | 1797 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Gas separation: Apparatus 096/7 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771569 | Yang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Los Alamos National Security, LLC (Los Alamos, New Mexico) |
| INVENTOR(S) | Dali Yang (Los Alamos, New Mexico); David Devlin (Santa Fe, New Mexico); Robert S. Barbero (Santa Cruz, New Mexico); Martin E. Carrera (Naperville, Illinois); Craig W. Colling (Warrenville, Illinois) |
| ABSTRACT | Light hydrocarbon enrichment is accomplished using a vertically oriented distillation column having a plurality of vertically oriented, nonselective micro/mesoporous hollow fibers. Vapor having, for example, both propylene and propane is sent upward through the distillation column in between the hollow fibers. Vapor exits neat the top of the column and is condensed to form a liquid phase that is directed back downward through the lumen of the hollow fibers. As vapor continues to ascend and liquid continues to countercurrently descend, the liquid at the bottom of the column becomes enriched in a higher boiling point, light hydrocarbon (propane, for example) and the vapor at the top becomes enriched in a lower boiling point light hydrocarbon (propylene, for example). The hollow fiber becomes wetted with liquid during the process. |
| FILED | Wednesday, May 20, 2009 |
| APPL NO | 12/469552 |
| ART UNIT | 1797 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Distillation: Processes, separatory 23/39 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771585 | Vimalchand et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Southern Company (Birmingham, Alabama) |
| INVENTOR(S) | Pannalal Vimalchand (Birmingham, Alabama); Guohai Liu (Birmingham, Alabama); WanWang Peng (Birmingham, Alabama) |
| ABSTRACT | The system of the present invention includes a centripetal cyclone for separating particulate material from a particulate laden gas solids stream. The cyclone includes a housing defining a conduit extending between an upstream inlet and a downstream outlet. In operation, when a particulate laden gas-solids stream passes through the upstream housing inlet, the particulate laden gas-solids stream is directed through the conduit and at least a portion of the solids in the particulate laden gas-solids stream are subjected to a centripetal force within the conduit. |
| FILED | Friday, March 09, 2007 |
| APPL NO | 11/684405 |
| ART UNIT | 1797 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Mineral oils: Processes and products 28/113 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771653 | Del Eckels et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Lawrence Livermore National Security, LLC (Livermore, California) |
| INVENTOR(S) | Joel Del Eckels (Livermore, California); Peter J. Nunes (Danville, California); Randall L. Simpson (Livermore, California); Richard E. Whipple (Livermore, California); J. Chance Carter (Livermore, California); John G. Reynolds (San Ramon, California) |
| ABSTRACT | An inspection tester system for testing for explosives. The tester includes a body and a swab unit adapted to be removeably connected to the body. At least one reagent holder and dispenser is operatively connected to the body. The reagent holder and dispenser contains an explosives detecting reagent and is positioned to deliver the explosives detecting reagent to the swab unit. A heater is operatively connected to the body and the swab unit is adapted to be operatively connected to the heater. |
| FILED | Wednesday, November 01, 2006 |
| APPL NO | 11/593257 |
| ART UNIT | 1797 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Chemical apparatus and process disinfecting, deodorizing, preserving, or sterilizing 422/58 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771784 | Loutfy et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Materials and Electrochemical Research (MER) Corporation (Tucson, Arizona) |
| INVENTOR(S) | Raouf O. Loutfy (Tucson, Arizona); Alexander P. Moravsky (Tucson, Arizona); Charles N. Hassen (Tucson, Arizona) |
| ABSTRACT | A method for forming a thin film material which comprises depositing solid particles from a flowing suspension or aerosol onto a filter and next adhering the solid particles to a second substrate using an adhesive. |
| FILED | Friday, March 10, 2006 |
| APPL NO | 11/885659 |
| ART UNIT | 1715 — Coating, Etching, Cleaning, Single Crystal Growth |
| CURRENT CPC | Coating processes 427/180 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771884 | Haltiner, Jr. et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Delphi Technololgies, Inc. (Troy, Michigan) |
| INVENTOR(S) | Karl J. Haltiner, Jr. (Fairport, New York); James S. Vordonis (Penfield, New York); John F. O'Brien (Lockport, New York) |
| ABSTRACT | An SOFC stack module including an integral individual stack manifold containing all of the gas pathways necessary for supply and exhaust of fuel gas and cathode air to and from the stack chimneys. The stack is mounted and hermetically joined directly to the manifold without an intermediate base plate. Flanges at the inlet and outlet ports couple to system distributary manifolds via high temperature sealing joints. The manifold preferably is fabricated of a ferritic stainless steel, and may be formed in a one-piece casting, a combination of multiple castings and stamped plates metallurgically joined (brazed or welded together), or stamped from sheet metal stock. Preferably, the manifold includes fin structures extending into adjacent fuel gas and cathode air chambers to enhance balancing of temperatures by heat exchange therebetween. Heat exchange may be further improved by configuring the manifold to have a plurality of interleaved anode and cathode gas supply chambers. |
| FILED | Wednesday, April 19, 2006 |
| APPL NO | 11/406958 |
| ART UNIT | 1795 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Chemistry: Electrical current producing apparatus, product, and process 429/458 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771887 | Morse et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Lawrence Livermore National Security, LLC (Livermore, California) |
| INVENTOR(S) | Jeffrey D. Morse (Martinez, California); Alan F. Jankowski (Livermore, California); Conrad Yu (Antioch, California) |
| ABSTRACT | An apparatus having a first substrate having (1) a cavity, (2) one or more resistive heaters, and (3) one or more coatings forming a diffusion barrier to hydrogen; a second substrate having (1) an outlet valve comprising a pressure relief structure and (2) one or more coatings forming a diffusion barrier to hydrogen, wherein said second substrate is coupled to said first substrate forming a sealed volume in said cavity; a metal hydride material contained within said cavity; and a gas distribution system formed by coupling a microfluidic interconnect to said pressure relief structure. Additional apparatuses and methods are also disclosed. |
| FILED | Monday, March 23, 2009 |
| APPL NO | 12/409392 |
| ART UNIT | 1795 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Chemistry: Electrical current producing apparatus, product, and process 429/510 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772150 | Vieth et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | UT-Battelle, LLC (Oak Ridge, Tennessee) |
| INVENTOR(S) | Gabriel M. Vieth (Knoxville, Tennessee); Nancy J. Dudney (Oak Ridge, Tennessee); Sheng Dai (Knoxville, Tennessee) |
| ABSTRACT | A method to prepare porous medium decorated with nanoparticles involves contacting a suspension of nanoparticles in an ionic liquid with a porous medium such that the particles diffuse into the pores of the medium followed by heating the resulting composition to a temperature equal to or greater than the thermal decomposition temperature of the ionic liquid resulting in the removal of the liquid portion of the suspension. The nanoparticles can be a metal, an alloy, or a metal compound. The resulting compositions can be used as catalysts, sensors, or separators. |
| FILED | Tuesday, May 01, 2007 |
| APPL NO | 11/742652 |
| ART UNIT | 1796 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Catalyst, solid sorbent, or support therefor: Product or process of making 52/326 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772361 | Klaehn et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Battelle Energy Alliance, LLC (Idaho Falls, Idaho) |
| INVENTOR(S) | John R. Klaehn (Idaho Falls, Idaho); Eric S. Peterson (Idaho Falls, Idaho); Alan K. Wertsching (Idaho Falls, Idaho); Christopher J. Orme (Shelley, Idaho); Thomas A. Luther (Idaho Falls, Idaho); Michael G. Jones (Pocatello, Idaho) |
| ABSTRACT | A PBI compound that includes imidazole nitrogens, at least a portion of which are substituted with an organic-inorganic hybrid moiety. At least 85% of the imidazole nitrogens may be substituted. The organic-inorganic hybrid moiety may be an organosilane moiety, for example, (R)Me2SiCH2—, where R is selected from among methyl, phenyl, vinyl, and allyl. The PBI compound may exhibit similar thermal properties in comparison to the unsubstituted PBI. The PBI compound may exhibit a solubility in an organic solvent greater than the solubility of the unsubstituted PBI. The PBI compound may be included in separatory media. A substituted PBI synthesis method may include providing a parent PBI in a less than 5 wt % solvent solution. Substituting may occur at about room temperature and/or at about atmospheric pressure. Substituting may use at least five equivalents in relation to the imidazole nitrogens to be substituted or, preferably, about fifteen equivalents. |
| FILED | Tuesday, July 03, 2007 |
| APPL NO | 11/772868 |
| ART UNIT | 1796 — Organic Chemistry |
| CURRENT CPC | Synthetic resins or natural rubbers 528/423 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772370 | Altier et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Pioneer Hi-Bred International, Inc (Johnston, Iowa); E.I. du Pont de Nemours and Company (Wilmington, Delaware); The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Daniel J. Altier (Waukee, Iowa); Glen Dahlbacka (Oakland, California); Irina Elleskaya (Kyiv, Ukraine); Natalia Ellanskaya, legal representative (Kyiv, Ukraine); Rafael Herrmann (Wilmington, Delaware); Jennie Hunter-Cevera (Elliott City, Maryland); Billy F. McCutchen (College Station, Iowa); James K. Presnail (Avondale, Pennsylvania); Janet A. Rice (Wilmington, Delaware); Eric Schepers (Port Deposit, Maryland); Carl R. Simmons (Des Moines, Iowa); Tamas Torok (Richmond, California); Nasser Yalpani (Johnston, Iowa) |
| ABSTRACT | Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include novel amino acid sequences, and variants and fragments thereof, for antipathogenic polypeptides that were isolated from microbial fermentation broths. Nucleic acid molecules comprising nucleotide sequences that encode the antipathogenic polypeptides of the invention are also provided. A method for inducing pathogen resistance in a plant using the nucleotide sequences disclosed herein is further provided. The method comprises introducing into a plant an expression cassette comprising a promoter operably linked to a nucleotide sequence that encodes an antipathogenic polypeptide of the invention. Compositions comprising an antipathogenic polypeptide or a transformed microorganism comprising a nucleic acid of the invention in combination with a carrier and methods of using these compositions to protect a plant from a pathogen are further provided. Transformed plants, plant cells, seeds, and microorganisms comprising a nucleotide sequence that encodes an antipathogenic polypeptide of the invention, or variant or fragment thereof, are also disclosed. |
| FILED | Friday, August 03, 2007 |
| APPL NO | 11/833598 |
| ART UNIT | 1652 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/370 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772412 | Holladay et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Battelle Memorial Institute (Richland, Washington) |
| INVENTOR(S) | Johnathan E. Holladay (Kennewick, Washington); Jianli Hu (Kennewick, Washington); Xinjie Zhang (Burlington, Massachusetts); Yong Wang (Richland, Washington) |
| ABSTRACT | The invention includes a method of dehydration of a sugar using a dehydration catalyst and a co-catalyst within a reactor. A sugar is introduced and H2 is flowed through the reactor at a pressure of less than or equal to about 300 psig to convert at least some of the sugar into an anhydrosugar product. The invention includes a process for producing isosorbide. A starting material comprising sorbitol is flowed into a reactor. H2 is counter flowed through the reactor. The starting material is exposed to a catalyst in the presence of a co-catalyst which comprises at least one metal. The exposing is conducted at a hydrogen pressure of less than or equal to 300 psig within the reactor and the hydrogen removes at least some of any water present during the exposing and inhibits formation of colored byproducts. |
| FILED | Thursday, January 26, 2006 |
| APPL NO | 11/341968 |
| ART UNIT | 1623 — Organic Chemistry |
| CURRENT CPC | Organic compounds 549/464 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772746 | Keolian et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Penn State Research Foundation (University Park, Pennsylvania) |
| INVENTOR(S) | Robert M. Keolian (State College, Pennsylvania); John W. Wuthrich (Albany, New York); Kevin J. Bastyr (Someville, Massachusetts) |
| ABSTRACT | An electroactive transducer converts between acoustical power and electrical power. The transducer includes a diaphragm and a perimeter member. The perimeter member includes at least one electroactive element and is mechanically coupled to the perimeter of the diaphragm such that displacement of the diaphragm stresses the electroactive element. |
| FILED | Tuesday, July 25, 2006 |
| APPL NO | 11/492311 |
| ART UNIT | 2837 — Electrical Circuits and Systems |
| CURRENT CPC | Electrical generator or motor structure 310/339 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772761 | Choulis et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Osram Opto Semiconductors GmbH (Regensburg, Germany) |
| INVENTOR(S) | Stelios A. Choulis (San Jose, California); Mathew Mathai (Santa Clara, California); Vi-En Choong (San Jose, California); Franky So (Gainesville, Florida) |
| ABSTRACT | Techniques are described for forming an organic light emitting diode device with improved device efficiency. Materials having at least one energy level that is similar to those of a phosphorescent light emitting material in the diode are incorporated into the device to directly inject holes or electrons to the light emitting material. |
| FILED | Wednesday, September 28, 2005 |
| APPL NO | 11/238888 |
| ART UNIT | 2889 — Electrical Circuits and Systems |
| CURRENT CPC | Electric lamp and discharge devices 313/504 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773773 | Abercrombie et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | UT-Battelle, LLC (Oak Ridge, Tennessee) |
| INVENTOR(S) | Robert K. Abercrombie (Knoxville, Tennessee); Bob G. Schlicher (Portsmouth, New Hampshire) |
| ABSTRACT | The invention provides a method and a computer program stored in a tangible medium for automatically determining a volume of three-dimensional objects represented in two-dimensional images, by acquiring at two least two-dimensional digitized images, by analyzing the two-dimensional images to identify reference points and geometric patterns, by determining distances between the reference points and the component objects utilizing reference data provided for the three-dimensional object, and by calculating a volume for the three-dimensional object. |
| FILED | Wednesday, October 18, 2006 |
| APPL NO | 11/583473 |
| ART UNIT | 2624 — Selective Visual Display Systems |
| CURRENT CPC | Image analysis 382/104 |
| VIEW PATENT | @ USPTO: Full Text PDF |
National Science Foundation (NSF)
| US 07771512 | Norton et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Washington State University Research Foundation (Pullman, Washington); Idaho Research Foundation, Inc. (Moscow, Idaho) |
| INVENTOR(S) | Grant Norton (Pullman, Washington); David McIIRoy (Moscow, Idaho) |
| ABSTRACT | Method and apparatus for storing hydrogen. One embodiment of such a method comprises providing a storage apparatus having a substrate and a nanostructure mat on at least a portion of a side of the substrate. The nanostructure mat comprises a plurality of nanostructures having a surface ionization state which causes more than one layer of hydrogen to adsorb onto the nanostructures. The method can also include exposing the nanostructure mat to hydrogen such that more than one layer of hydrogen adsorbs onto the nanostructures. |
| FILED | Thursday, December 20, 2007 |
| APPL NO | 11/961928 |
| ART UNIT | 1797 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Gas separation: Processes 095/116 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771732 | Peppas et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Board of Regents, The University of Texas System (Austin, Texas) |
| INVENTOR(S) | Nicholas A. Peppas (Austin, Texas); James Z. Hilt (Lexington, Kentucky); Mark E. Byrne (Auburn, Alabama) |
| ABSTRACT | Biomimetic polymer networks comprising a heteropolymer network having a cavity, the cavity having a selective affinity for a moiety, methods for making biomimetic polymer networks, and methods for using biomimetic polymer networks. |
| FILED | Friday, April 28, 2006 |
| APPL NO | 11/380803 |
| ART UNIT | 1618 — Organic Compounds: Bio-affecting, Body Treating, Drug Delivery, Steroids, Herbicides, Pesticides, Cosmetics, and Drugs |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/400 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771787 | Velegol et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Penn State Research Foundation (University Park, Pennsylvania) |
| INVENTOR(S) | Darrell Velegol (State College, Pennsylvania); Jason D. Feick (Auburndale, Massachusetts); Allison M. Yake (Landenberg, Pennsylvania); Charles E. Snyder (State College, Pennsylvania) |
| ABSTRACT | Particles having a non-uniform property, such as non-uniform charge, can be used to form complex yet controlled particle assemblies. In one method of fabrication, particles are located on a substrate, and a surface treatment applied to the exposed portion of the particle surface. The surface treatment modifies the particle properties within the exposed portion. One or more lithographed regions are not exposed to the surface treatment, providing spatial selectivity in inter-particle bonding after the particles are removed from the substrate. |
| FILED | Thursday, August 25, 2005 |
| APPL NO | 11/211312 |
| ART UNIT | 1792 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Coating processes 427/212 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771793 | Wynne et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Virginia Commonwealth University (Richmond, Virginia); The United States of America as represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | Kenneth Joseph Wynne (Midlothian, Virginia); Biao Duan (Richmond, Virginia); Steven Grunzinger (Tokyo, Japan); Umit Makal (Strongsville, Ohio); Pinar Kurt (Richmond, Virginia); James Wynne (Alexandria, Virginia) |
| ABSTRACT | Polymers, and particularly conventional commodity bulk polymers, are modified to have a surface activity of interest using a surface modifying polymer that includes a moiety that favors migration to the surface of the bulk polymer together with a moiety provides the activity of interest (e.g., biocidal, wettability modifying (hydrophobic or hydrophilic), resistance to radiant energy, providing a functional group for functionalizing the surface, etc.). The surface modifying polymer is combined with the bulk polymer, and, due to the presence of the moiety that favors migration, concentrates primarily on the surface of the bulk polymer such that the moiety that provides the activity of interest is located primarily on the surface of the bulk polymeric article which is produced. Advantageously, only a minimal amount (such as, e.g., about 2 weight %) of polymeric surface modifier is needed. Being able to achieve desired properties (such as biocidal activity, wettability modification, etc.) without needing much polymeric surface modifier is highly advantageous. |
| FILED | Thursday, December 01, 2005 |
| APPL NO | 11/290803 |
| ART UNIT | 1794 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Coating processes 427/401 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771824 | Herrera-Alonso et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Trustees of Princeton University (Princeton, New Jersey) |
| INVENTOR(S) | Margarita Herrera-Alonso (Princeton, New Jersey); Michael J. McAllister (Princeton, New Jersey); Ilhan A. Aksay (Princeton, New Jersey); Robert K. Prud'homme (Princeton, New Jersey) |
| ABSTRACT | Bridged graphite oxide material comprising graphite sheets bridged by at least one diamine bridging group. The bridged graphite oxide material may be incorporated in polymer composites or used in adsorption media. |
| FILED | Thursday, September 04, 2008 |
| APPL NO | 12/204292 |
| ART UNIT | 1796 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Stock material or miscellaneous articles 428/408 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771825 | Wynne et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Virginia Commonwealth University (Richmond, Virginia) |
| INVENTOR(S) | Kenneth Joseph Wynne (Midlothian, Virginia); Biao Duan (Richmond, Virginia); Steven Grunzinger (Tokyo, Japan); Umit Makal (Strongsville, Ohio); Pinar Kurt (Richmond, Virginia) |
| ABSTRACT | Polymers, and particularly conventional commodity bulk polymers, are modified to have a surface activity of interest using a surface modifying polymer that includes a moiety that favors migration to the surface of the bulk polymer together with a moiety provides the activity of interest (e.g., biocidal, wettability modifying (hydrophobic or hydrophilic), resistance to radiant energy, providing a functional group for functionalizing the surface, etc.). The surface modifying polymer is combined with the bulk polymer, and, due to the presence of the moiety that favors migration, concentrates primarily on the surface of the bulk polymer such that the moiety that provides the activity of interest is located primarily on the surface of the bulk polymeric article which is produced. Advantageously, only a minimal amount (such as, e.g., about 2 weight %) of polymeric surface modifier is needed. Being able to achieve desired properties (such as biocidal activity, wettability modification, etc.) without needing much polymeric surface modifier is highly advantageous. |
| FILED | Tuesday, March 14, 2006 |
| APPL NO | 11/374421 |
| ART UNIT | 1794 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Stock material or miscellaneous articles 428/411.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
07771938 — Nonlinear spectroscopic methods for identifying and characterizing molecular interactions
| US 07771938 | Zanni et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Wisconsin Alumni Research Foundation (Madison, Wisconsin) |
| INVENTOR(S) | Martin T. Zanni (Madison, Wisconsin); John C. Wright (Oregon, Wisconsin); Eric C. Fulmer (Madison, Wisconsin) |
| ABSTRACT | This invention provides methods and devices for identifying and/or characterizing interactions involving molecules, including, but not limited to, identifying and/or characterizing interactions involving target molecules and candidate molecules. The present invention provides methods using multidimensional infrared spectrographic techniques, such as four wave mixing and pump-probe techniques, for identifying interactions involving biomolecules and therapeutic candidate molecules, and for characterizing such interactions in terms of their binding coefficients and/or equilibrium constants. |
| FILED | Thursday, September 15, 2005 |
| APPL NO | 11/228042 |
| ART UNIT | 1634 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/6 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07771981 | DeAngelis |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Board of Regents of the University of Oklahoma (Norman, Oklahoma) |
| INVENTOR(S) | Paul L. DeAngelis (Edmond, Oklahoma) |
| ABSTRACT | The presently claimed and disclosed invention relates, in general, to dual action heparin synthases and, more particularly, to dual action heparin synthases obtained from Pasteurella multocida. The presently claimed and disclosed invention also relates to heparosan, heparin and heparin-like molecules provided by recombinant techniques and methods of using such molecules and also the identification or prediction of heparin synthases or component single action enzymes. The presently claimed and disclosed invention also relates to methods, and molecules produced according to such methods, for using the presently claimed and disclosed heparosan and/or heparin synthase for polymer grafting and the production of non-naturally occurring chimeric polymers incorporating stretches of one or more acidic GAG molecules, such as heparin, chondroitin, hyaluronan, and/or heparosan. |
| FILED | Monday, October 22, 2007 |
| APPL NO | 11/975811 |
| ART UNIT | 1652 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/252.300 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772367 | Fine et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Trustees of Columbia University in the City of New York (New York, New York) |
| INVENTOR(S) | Robert L. Fine (Tenafly, New Jersey); Paul Brandt-Rauf (Scarsdale, New York); Yueha Mao (New York, New York) |
| ABSTRACT | Disclosed are polypeptides comprising a first segment of continuous amino acids having the sequence AQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (SEQ ID NO. 1) covalently linked to a second segment of continuous amino acids having the sequence DSDPGETKFMLKKHRSTSQGKKSKLHSSHARSGGPEKGAQA (SEQ ID NO. 2), or at least two of each covalently linked to each ether. The polypeptides are shown to induce apoptosis of cancer cells that contain mutant p53 or over-expressed wild-type p53. |
| FILED | Thursday, January 27, 2005 |
| APPL NO | 10/587606 |
| ART UNIT | 1642 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/350 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772383 | Chakrabarti et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Trustees of Princeton University (Princeton, New Jersey) |
| INVENTOR(S) | Raj Chakrabarti (New York, New York); Clarence Schutt (Princeton, New Jersey) |
| ABSTRACT | A composition for performing a polynucleotide amplification reaction at low temperature, including a polynucleotide amplification reaction mixture into which is incorporated a sufficiently high concentration of a low molecular weight compound selected from the group consisting of amides, sulfones, sulfoxides and diols, to accomplish the amplification at the low temperature. In another embodiment, a composition for enhancing a polynucleotide amplification reaction, including a polynucleotide amplification reaction mixture into which is incorporated a low molecular weight diol in an amount effective to enhance the polynucleotide amplification. |
| FILED | Wednesday, March 03, 2004 |
| APPL NO | 10/792404 |
| ART UNIT | 1637 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Organic compounds 536/22.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772416 | MacGillivray |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Iowa Research Foundation (Iowa City, Iowa) |
| INVENTOR(S) | Leonard R. MacGillivray (Iowa City, Iowa) |
| ABSTRACT | The invention provides metal-organic complexes useful for storing information in an information storage system. The invention also provides methods for forming such complexes on a substrate, as well as apparatuses and systems comprising such complexes. |
| FILED | Friday, June 10, 2005 |
| APPL NO | 11/150587 |
| ART UNIT | 1621 — Organic Chemistry |
| CURRENT CPC | Organic compounds 556/32 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772543 | Grier et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | New York University (New York, New York); Harvard University (Cambridge, Massachusetts) |
| INVENTOR(S) | David G. Grier (New York, New York); Ritesh Agarwal (Philadelphia, Pennsylvania); Guihua Yu (Cambridge, Massachusetts); Charles M. Lieber (Cambridge, Massachusetts); Kosta Ladavac (Ridgefield, Connecticut); Yael Roichman (New York, New York) |
| ABSTRACT | A system and method for manipulating and processing nanowires in solution with arrays of holographic optical traps. The system and method of the present invention is capable of creating hundreds of individually controlled optical traps with the ability to manipulate objects in three dimensions. Individual nanowires with cross-sections as small as 20 nm and lengths exceeding 20 μm are capable of being isolated, translated, rotated and deposited onto a substrate with holographic optical trap arrays under conditions where single traps have no discernible influence. Spatially localized photothermal and photochemical processes induced by the well-focused traps can also be used to melt localized domains on individual nanowires and to fuse nanowire junctions. |
| FILED | Wednesday, January 11, 2006 |
| APPL NO | 11/329579 |
| ART UNIT | 2881 — Optics |
| CURRENT CPC | Radiant energy 250/251 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07774725 | Jain et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Purdue Research Foundation (West Lafayette, Indiana) |
| INVENTOR(S) | Jitesh Jain (Rajasthan, India); Stephen F. Cauley (West Lafayette, Indiana); Hong Li (He nan, China PRC); Cheng-Kok Koh (West Lafayette, Indiana); Venkataramanan Balakrishnan (West Lafayette, Indiana) |
| ABSTRACT | A method of simulating operation of a VLSI interconnect structure having capacitive and inductive coupling between nodes thereof. A matrix X and a matrix Y containing different combinations of passive circuit element values for the interconnect structure are obtained where the element values for each matrix include inductance L and inverse capacitance P. An adjacency matrix A associated with the interconnect structure is obtained. Numerical integration is used to solve first and second equations, each including as a factor the product of the inverse matrix X1 and at least one other matrix, with first equation including X1Y, X1A, and X1P, and the second equation including X1A and X1P. |
| FILED | Monday, November 06, 2006 |
| APPL NO | 11/593465 |
| ART UNIT | 2825 — Semiconductors/Memory |
| CURRENT CPC | Computer-aided design and analysis of circuits and semiconductor masks 716/4 |
| VIEW PATENT | @ USPTO: Full Text PDF |
National Aeronautics and Space Administration (NASA)
| US 07771824 | Herrera-Alonso et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The Trustees of Princeton University (Princeton, New Jersey) |
| INVENTOR(S) | Margarita Herrera-Alonso (Princeton, New Jersey); Michael J. McAllister (Princeton, New Jersey); Ilhan A. Aksay (Princeton, New Jersey); Robert K. Prud'homme (Princeton, New Jersey) |
| ABSTRACT | Bridged graphite oxide material comprising graphite sheets bridged by at least one diamine bridging group. The bridged graphite oxide material may be incorporated in polymer composites or used in adsorption media. |
| FILED | Thursday, September 04, 2008 |
| APPL NO | 12/204292 |
| ART UNIT | 1796 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Stock material or miscellaneous articles 428/408 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772550 | Schaefer et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | California Institute of Technology (Pasadena, California) |
| INVENTOR(S) | Rembrandt Thomas Schaefer (Pasadena, California); Mohammad Mojarradi (La Canada, California); Ara Chutjian (La Crescenta, California); Murray R. Darrach (Valencia, California); John MacAskill (Pasadena, California); Tuan Tran (Upland, California); Gary R. Burke (Moorpark, California); Stojan M. Madzunkov (Monrovia, California); Brent R. Blaes (San Dimas, California); John L. Thomas (Duarte, California); Ryan A. Stern (Los Angeles, California); David Q. Zhu (Pasadena, California) |
| ABSTRACT | The present invention discloses an mixed signal RF drive electronics board that offers small, low power, reliable, and customizable method for driving and generating mass spectra from a mass spectrometer, and for control of other functions such as electron ionizer, ion focusing, single-ion detection, multi-channel data accumulation and, if desired, front-end interfaces such as pumps, valves, heaters, and columns. |
| FILED | Thursday, May 03, 2007 |
| APPL NO | 11/800421 |
| ART UNIT | 2881 — Optics |
| CURRENT CPC | Radiant energy 250/290 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773121 | Huntsberger et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Administrator of the National Aeronautics and Space Administration (Washington, District of Columbia) |
| INVENTOR(S) | Terrance L. Huntsberger (Altadena, California); Robert C. Stirbl (Pasadena, California); Hrand Aghazarian (La Crescenta, California); Curtis W. Padgett (Los Angeles, California) |
| ABSTRACT | A high resolution CMOS imaging system especially suitable for use in a periscope head. The imaging system includes a sensor head for scene acquisition, and a control apparatus inclusive of distributed processors and software for device-control, data handling, and display. The sensor head encloses a combination of wide field-of-view CMOS imagers and narrow field-of-view CMOS imagers. Each bank of imagers is controlled by a dedicated processing module in order to handle information flow and image analysis of the outputs of the camera system. The imaging system also includes automated or manually controlled display system and software for providing an interactive graphical user interface (GUI) that displays a full 360-degree field of view and allows the user or automated ATR system to select regions for higher resolution inspection. |
| FILED | Friday, April 27, 2007 |
| APPL NO | 11/741213 |
| ART UNIT | 2622 — Selective Visual Display Systems |
| CURRENT CPC | Television 348/218.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773201 | Hayden et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | ITT Manufacturing Enterprises, Inc. (Wilmington, Delaware) |
| INVENTOR(S) | Joseph E. Hayden (Spencerport, New York); Eugene G. Olczak (Pittsford, New York) |
| ABSTRACT | A system for testing an optical surface includes a rangefinder configured to emit a light beam and a null assembly located between the rangefinder and the optical surface. The null assembly is configured to receive and to reflect the emitted light beam toward the optical surface. The light beam reflected from the null assembly is further reflected back from the optical surface toward the null assembly as a return light beam. The rangefinder is configured to measure a distance to the optical surface using the return light beam. |
| FILED | Tuesday, December 04, 2007 |
| APPL NO | 11/999078 |
| ART UNIT | 2877 — Optics |
| CURRENT CPC | Optics: Measuring and testing 356/4.10 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773205 | Cooper et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | California Institute of Technology (Pasadena, California) |
| INVENTOR(S) | Ken B. Cooper (La Canada, California); Goutam Chattopadhyay (Pasadena, California); Peter H. Siegel (La Canada, California); Robert J. Dengler (Diamond Bar, California); Erich T. Schlecht (Pasadena, California); Imran Mehdi (South Pasadena, California); Anders J. Skalare (Pasadena, California) |
| ABSTRACT | A three-dimensional imaging radar operating at high frequency e.g., 670 GHz, is disclosed. The active target illumination inherent in radar solves the problem of low signal power and narrow-band detection by using submillimeter heterodyne mixer receivers. A submillimeter imaging radar may use low phase-noise synthesizers and a fast chirper to generate a frequency-modulated continuous-wave (FMCW) waveform. Three-dimensional images are generated through range information derived for each pixel scanned over a target. A peak finding algorithm may be used in processing for each pixel to differentiate material layers of the target. Improved focusing is achieved through a compensation signal sampled from a point source calibration target and applied to received signals from active targets prior to FFT-based range compression to extract and display high-resolution target images. Such an imaging radar has particular application in detecting concealed weapons or contraband. |
| FILED | Friday, June 06, 2008 |
| APPL NO | 12/135040 |
| ART UNIT | 3662 — Computerized Vehicle Controls and Navigation, Radio Wave, Optical and Acoustic Wave Communication, Robotics, and Nuclear Systems |
| CURRENT CPC | Optics: Measuring and testing 356/5.150 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773362 | Wirz |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Administrator of the National Aeronautics and Space Administration (Washington, District of Columbia) |
| INVENTOR(S) | Richard E. Wirz (Altadena, California) |
| ABSTRACT | An accelerator system and method that utilize dust as the primary mass flux for generating thrust are provided. The accelerator system can include an accelerator capable of operating in a self-neutralizing mode and having a discharge chamber and at least one ionizer capable of charging dust particles. The system can also include a dust particle feeder that is capable of introducing the dust particles into the accelerator. By applying a pulsed positive and negative charge voltage to the accelerator, the charged dust particles can be accelerated thereby generating thrust and neutralizing the accelerator system. |
| FILED | Wednesday, March 07, 2007 |
| APPL NO | 11/683007 |
| ART UNIT | 2836 — Electrical Circuits and Systems |
| CURRENT CPC | Electricity: Electrical systems and devices 361/226 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07774060 | Westenskow et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Utah Research Foundation (Salt Lake City, Utah); Axon Medical, Inc. (Park City, Utah) |
| INVENTOR(S) | Dwayne R. Westenskow (Salt Lake City, Utah); Joseph A. Orr (Park City, Utah); Noah Syroid (Salt Lake City, Utah); Daniel Snell (Tucson, Arizona); James Agutter (Salt Lake City, Utah); Frank Drews (Salt Lake City, Utah); Srinath Lingutla (Salt Lake City, Utah); Santosh Balakrishnan (Salt Lake City, Utah); Kai Kuck (Hamburg, Germany); Lara Brewer (Bountiful, Utah) |
| ABSTRACT | A basic life support system (BLSS) includes a processing element and an output element, such as a display screen or an audio output element, for providing an individual with real-time instructions on providing emergency medical care to a patient until paramedics or other healthcare professionals arrive to take over care for the patient. The instructions may be provided as graphics, including animations, as text, audibly, or as a combination of visible and audible elements. The BLSS may be configured for providing emergency medical care to individuals who have suffered from ventricular fibrillation. Accordingly, the BLSS may also include a defibrillation apparatus, an air or oxygen supply, a respiratory interface, one or more sensors, or a combination thereof. |
| FILED | Monday, June 20, 2005 |
| APPL NO | 11/157218 |
| ART UNIT | 3766 — Sheet Container Making, Package Making, Receptacles, Shoes, Apparel, and Tool Driving or Impacting |
| CURRENT CPC | Surgery: Light, thermal, and electrical application 67/5 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07774725 | Jain et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Purdue Research Foundation (West Lafayette, Indiana) |
| INVENTOR(S) | Jitesh Jain (Rajasthan, India); Stephen F. Cauley (West Lafayette, Indiana); Hong Li (He nan, China PRC); Cheng-Kok Koh (West Lafayette, Indiana); Venkataramanan Balakrishnan (West Lafayette, Indiana) |
| ABSTRACT | A method of simulating operation of a VLSI interconnect structure having capacitive and inductive coupling between nodes thereof. A matrix X and a matrix Y containing different combinations of passive circuit element values for the interconnect structure are obtained where the element values for each matrix include inductance L and inverse capacitance P. An adjacency matrix A associated with the interconnect structure is obtained. Numerical integration is used to solve first and second equations, each including as a factor the product of the inverse matrix X1 and at least one other matrix, with first equation including X1Y, X1A, and X1P, and the second equation including X1A and X1P. |
| FILED | Monday, November 06, 2006 |
| APPL NO | 11/593465 |
| ART UNIT | 2825 — Semiconductors/Memory |
| CURRENT CPC | Computer-aided design and analysis of circuits and semiconductor masks 716/4 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Agriculture (USDA)
| US 07771528 | Selling et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of Agriculture (Washington, District of Columbia) |
| INVENTOR(S) | Gordon W. Selling (Dunlap, Illinois); Kristen K. Woods (Peoria, Illinois) |
| ABSTRACT | Zein articles are prepared by a melt process where zein is mixed with glyoxal and an inorganic base solution at temperatures above about 40° C. The melt processing can take as a batch process (e.g., as in a torque rheometer) or in a continuous process (e.g., as in reaction extrusion using a screw extruder). This process provides a zein article that has greatly reduced solubility in most of the standard organic solvents that will dissolve unaltered zein. |
| FILED | Thursday, August 16, 2007 |
| APPL NO | 11/893463 |
| ART UNIT | 1793 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Compositions: Coating or plastic 16/156.300 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772195 | Nair et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Board of Trustees of Michigan State University (East Lansing, Michigan) |
| INVENTOR(S) | Muraleedharan G. Nair (Okemos, Michigan); Bolleddula Jayaprakasam (East Lansing, Michigan); Lawrence K. Olson (East Lansing, Michigan); Robert E. Schutzki (Eaton Rapids, Michigan) |
| ABSTRACT | A method for the treatment of obesity, diabetes, high cholesterol and related diseases including hyperglycemia, lipid disorders, hyperglyceridemia, dyslipidemia and atherosclerosis in mammals using anthocyanins, anthocyanidins, ursolic acid and/or betulinic acid is described. Compositions adapted for these treatments are also described. |
| FILED | Friday, March 04, 2005 |
| APPL NO | 11/072151 |
| ART UNIT | 1623 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/27 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772462 | Jahn et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Cornell Research Foundation, Inc. (Ithaca, New York) |
| INVENTOR(S) | Margaret M. Jahn (Lansing, New York); Byoung-Cheorl Kang (Ithaca, New York) |
| ABSTRACT | The present invention relates to methods of imparting virus resistance to plants. In one aspect, this method involves silencing a gene encoding a translation initiation factor eIF4E in the plant. In another aspect, this method involves overexpressing a heterologous translation initiation factor eIF4E in a plant. The present invention further relates to a genetic construct containing a nucleic acid molecule encoding a heterologous translation initiation factor eIF4E, as well as to an expression system containing the genetic construct and a host cell transformed with the genetic construct. The present invention also relates to transgenic plants, seeds, and plant parts transformed with the genetic construct. The present invention also relates to an isolated nucleic acid molecule encoding a mutant translation initiation factor eIF4E that is effective in imparting virus resistance in plants. The present invention also relates to a mutant translation initiation factor eIF4E and a method for making the mutant. |
| FILED | Wednesday, December 17, 2003 |
| APPL NO | 10/538434 |
| ART UNIT | 1638 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Multicellular living organisms and unmodified parts thereof and related processes 8/279 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Commerce (DOC)
| US 07771496 | Nakahara et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Quallion LLC (Sylmar, California) |
| INVENTOR(S) | Hiroshi Nakahara (Santa Clarita, California); Sang Young Yoon (Saugus, California) |
| ABSTRACT | A method of a reducing impurities in an electrolyte includes contacting one or more components of an electrolyte with a zeolite. The method also includes activating one or more anode and one or more cathodes with the electrolyte. Contacting the one or more components with the zeolite can include contacting the electrolyte with the zeolite. In some instances, the method includes preparing the electrolyte after contacting the one or more components of the electrolyte with the zeolite. |
| FILED | Tuesday, February 08, 2005 |
| APPL NO | 11/053338 |
| ART UNIT | 1795 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Metal working 029/623.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07772710 | Silver et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Sematech, Inc. (Austin, Texas); National Institute of Standards and Technology (Gaithersburg, Maryland) |
| INVENTOR(S) | Richard Silver (Derwood, Maryland); Pete Lipscomb (Cedar Park, Texas); Bryan Barnes (Derwood, Maryland); Ravikirran Attota (Germantown, Maryland) |
| ABSTRACT | A zero-order overlay target comprises a first zero-order line array fabricated on a first layer of a semiconductor structure, the first zero-order line array having a first pitch, and a second zero-order line array fabricated on a second layer of the semiconductor structure, the second zero-order line array having a second pitch. The second pitch may be different from the first pitch, and a portion of the second zero-order line array may be positioned to become optically coupled to a portion of the first zero-order line array when subject to an overlay measurement. Further, the second pitch may be variable. For example, the variable pitch may comprise a first set of features having a pitch approximately equal to the first pitch, a second set of features having a pitch different from the first pitch, and a third set of features having a pitch approximately equal to the first pitch. |
| FILED | Wednesday, October 31, 2007 |
| APPL NO | 11/931140 |
| ART UNIT | 2818 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/797 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773330 | Itagi et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Seagate Technology LLC (Scotts Valley, California) |
| INVENTOR(S) | Amit Itagi (Pittsburgh, Pennsylvania); Daniel D. Stancil (Mars, Pennsylvania); Tuviah E. Schlesinger (Mt. Lebanon, Pennsylvania); James A. Bain (Pittsburgh, Pennsylvania) |
| ABSTRACT | An apparatus for producing an optical spot on the order of 25 nm in a recording media. The apparatus includes an optical transducer comprising a waveguide which defines an aperture adjacent to an air bearing surface of the transducer adjacent a recording media. The transducer includes a protrusion extending beyond the plane of the air bearing surface extending toward the recording media. |
| FILED | Friday, April 15, 2005 |
| APPL NO | 11/106980 |
| ART UNIT | 2627 — Selective Visual Display Systems |
| CURRENT CPC | Dynamic magnetic information storage or retrieval 360/59 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Transportation (USDOT)
| US 07774060 | Westenskow et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Utah Research Foundation (Salt Lake City, Utah); Axon Medical, Inc. (Park City, Utah) |
| INVENTOR(S) | Dwayne R. Westenskow (Salt Lake City, Utah); Joseph A. Orr (Park City, Utah); Noah Syroid (Salt Lake City, Utah); Daniel Snell (Tucson, Arizona); James Agutter (Salt Lake City, Utah); Frank Drews (Salt Lake City, Utah); Srinath Lingutla (Salt Lake City, Utah); Santosh Balakrishnan (Salt Lake City, Utah); Kai Kuck (Hamburg, Germany); Lara Brewer (Bountiful, Utah) |
| ABSTRACT | A basic life support system (BLSS) includes a processing element and an output element, such as a display screen or an audio output element, for providing an individual with real-time instructions on providing emergency medical care to a patient until paramedics or other healthcare professionals arrive to take over care for the patient. The instructions may be provided as graphics, including animations, as text, audibly, or as a combination of visible and audible elements. The BLSS may be configured for providing emergency medical care to individuals who have suffered from ventricular fibrillation. Accordingly, the BLSS may also include a defibrillation apparatus, an air or oxygen supply, a respiratory interface, one or more sensors, or a combination thereof. |
| FILED | Monday, June 20, 2005 |
| APPL NO | 11/157218 |
| ART UNIT | 3766 — Sheet Container Making, Package Making, Receptacles, Shoes, Apparel, and Tool Driving or Impacting |
| CURRENT CPC | Surgery: Light, thermal, and electrical application 67/5 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07774293 | Mosleh et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Maryland (College Park, Maryland) |
| INVENTOR(S) | Ali Mosleh (Columbia, Maryland); Chengdong Wang (Greenbelt, Maryland); Franciscus J. Groen (College Park, Maryland) |
| ABSTRACT | A hybrid causal framework applies properties of probabilistic models, such as Bayesian belief networks, to causal logic models, such as fault trees and event sequence diagrams. The probabilistic model establishes a joint probability distribution of causal relationships between events and conditions in the logic models. The probability of the events and conditions are found by propagating probabilities from the probabilistic model through the logic models. |
| FILED | Friday, March 17, 2006 |
| APPL NO | 11/377313 |
| ART UNIT | 2129 — AI & Simulation/Modeling |
| CURRENT CPC | Data processing: Artificial intelligence 76/53 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Veterans Affairs (DVA)
| US 07771956 | Gilbert et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Brigham and Women's Hospital, Inc. (Boston, Massachusetts); United States of America Department of Veterans Affairs (Washington, District of Columbia) |
| INVENTOR(S) | Gary E. Gilbert (Winchester, Massachusetts); Jialan Shi (Newton, Massachusetts); Christian W. Heegaard (Egaa, Denmark); Jan T. Rasmussen (Ry, Denmark) |
| ABSTRACT | A method, kit and probe for detecting the presence of a phospholipid, such as phosphatidylserine, in a biological material is provided. A binding agent including lactadherin, a fragment of lactadherin, a functional equivalent of lactadherin, or a functional equivalent of a fragment of lactadherin, is used to detect the presence of any phospholipid. |
| FILED | Wednesday, June 30, 2004 |
| APPL NO | 10/562269 |
| ART UNIT | 1657 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/7.200 |
| VIEW PATENT | @ USPTO: Full Text PDF |
National Geospatial Intelligence Agency (NGA)
| US 07774291 | Fleming et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Saffron Technology, Inc. (Morrisville, North Carolina) |
| INVENTOR(S) | James S. Fleming (Apex, North Carolina); Brian J. McGiverin (Richmond, Virginia); Manuel Aparicio, IV (Chapel Hill, North Carolina) |
| ABSTRACT | Associative memory systems, methods and/or computer program products include a network of networks of associative memory networks. A network of entity associative memory networks is provided, a respective entity associative memory of which includes associations among a respective observer entity and observed entities that are observed by the respective observer entity, based on input documents. A network of feedback associative memory networks includes associations among observed entities for a respective positive and/or negative evaluation for a respective task of a respective user. A network of document associative memory networks includes associations among observed entities in a respective observed input source, such as a respective input document. A network of community associative memory networks includes associations among a respective observer entity, observed entities that are observed by the respective observer entity, and observed tasks of users in which the observer entity was queried. Associations may be observed into and imagined from the network of networks of associative memory networks. |
| FILED | Friday, December 05, 2008 |
| APPL NO | 12/329239 |
| ART UNIT | 2129 — AI & Simulation/Modeling |
| CURRENT CPC | Data processing: Artificial intelligence 76/46 |
| VIEW PATENT | @ USPTO: Full Text PDF |
United States Postal Service (USPS)
| US 07774093 | Reese et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | United States Postal Service (Washington, District of Columbia) |
| INVENTOR(S) | Margaret Reese (Tempe, Arizona); Thomas Amonette (Greenfield, Indiana) |
| ABSTRACT | The invention relates to a method of obtaining a random sample. The method includes randomly selecting a sample of a mailing at a DMU. This sample is then analyzed for conformance with United States Postal Service standards. |
| FILED | Monday, March 06, 2006 |
| APPL NO | 11/367326 |
| ART UNIT | 3651 — Material and Article Handling |
| CURRENT CPC | Data processing: Generic control systems or specific applications 7/213 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Government Rights Acknowledged
| US 07771880 | Kumar et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | University of Dayton (Dayton, Ohio) |
| INVENTOR(S) | Binod Kumar (Dayton, Ohio); Joykumar Singh Thokchom (Dayton, Ohio) |
| ABSTRACT | A solid composite electrolyte membrane for use in a lithium battery is provided which exhibits a conductivity ranging from about 10−4 S cm−1 to about 10−3 S cm−1 at ambient temperature. The membrane is formed by providing a glass or glass-ceramic powder formed from a mixture of lithium carbonate, alumina, titanium dioxide, and ammonium dihydrogen phosphate. The powder is mixed with a conditioning agent and at least one solvent, followed by the addition of a binder and one or more plasticizers. The resulting slurry is cast into a tape which is then subjected to a binder burn-off and sintering process to form the membrane. The resulting membrane may be a glass-ceramic composite having a porosity ranging from 0 to 50%, or the membrane may be further infiltrated with a polymer to form a water-impermeable polymeric-ceramic composite membrane. |
| FILED | Monday, November 20, 2006 |
| APPL NO | 11/601965 |
| ART UNIT | 1795 — Food, Analytical Chemistry, Sterilization, Biochemistry, Electrochemistry |
| CURRENT CPC | Chemistry: Electrical current producing apparatus, product, and process 429/320 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 07773551 | Barnhart et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | |
| ASSIGNEE(S) | Raytheon Company (Waltham, Massachusetts) |
| INVENTOR(S) | Randy C. Barnhart (Parker, Colorado); Donald V. Schnaidt (Centennial, Colorado); Steven W. Talcott (Larkspur, Colorado); Craig S. Kloosterman (Denver, Colorado); Melinda C. Milani (Parker, Colorado) |
| ABSTRACT | In one embodiment, a system for data handling in a distributed communication network includes one or more data-handling nodes (DHNs) that each reside at one of one or more receptors. Each receptor is operable to receive first data units from one or more remote units. Each DHN is operable to extract second data units from the first data units, add extensions to the second data units for tracking the second data units in the distributed communication network, store the second data units locally at the receptor, generate log files of the second data units for communication to a data monitoring and recovery (DMR) agent at the receptor, and communicate the second data units with the added extensions to a routing system for routing the second data units in the distributed communication network. |
| FILED | Friday, March 18, 2005 |
| APPL NO | 11/083380 |
| ART UNIT | 2473 — Multiplex and VoIP |
| CURRENT CPC | Multiplex communications 370/316 |
| VIEW PATENT | @ USPTO: Full Text PDF |
How To Use This Page
THE FEDINVENT PATENT DETAILS PAGE
Each week, FedInvent analyzes newly granted patents and published patent applications whose origins lead back to funding by the US Federal Government. The FedInvent Patent Details page is a companion to the weekly FedInvents Patents Report.
This week's information is published in the FedInvent Patents report for Tuesday, August 10, 2010.
The FedInvent Weekly Patent Details Page contains a subset of patent information to provide a deeper dive into the week’s taxpayer-funded patents to help the reader better understand where a patent fits in the federal innovation ecosphere.
HOW IS THE INFORMATION ORGANIZED?
Patents are organized by the funding agency. Within each group, the patents are organized in numeric order. A patent funded by more than one agency will appear in the section of each of the agencies that funded the research and development that resulted in the invention. This approach gives the reader a complete view of the department or agency activity for the week.
WHAT INFORMATION WILL I FIND?
THE PANEL
There is a panel for each patent that contains the patent number and the title of the patent. When you click the panel, it opens to reveal the following information:
FUNDED BY
The agencies that funded the grants, contracts, or other research agreements that resulted in the patent. FedInvent includes as much information on the source of the funding as possible. The information is presented in a hierarchy going from the Federal Department down to the agencies, subagencies, and offices that funded the work. Here are two examples:
Department of Health and Human Services (HHS)
National Institutes of Health (NIH)
National Institute of Diabetes and Digestive and Kidney Diseases (NIDDK)
Department of Defense (DOD)
Defense Advanced Research Projects Agency (DARPA)
Army Research Office (ARO)
We do our best to provide detailed information about the funding. In some cases, the patent only reports limited information on the origins of the funding. FedInvents presents what it can confirm. We add the patents without the information required by the Bayh-Dole Act to our list of patents worthy of further investigation.
APPLICANT(S) and ASSIGNEES
FedInvent includes both the Applicants and the Assignees because having both provides more information about where the inventive work was done and by what organizations. Many organizations — universities, corporations, and federal agencies — standardize the Assignee/Owner information by the time a patent is granted. In the case of federal patents, many of the patents use the agency headquarters information for patent assignment.
Showing just the headquarters address would make Washington, DC the epicenter of all taxpayer-funded research and development. Providing both the applicant information and the assignee information provides a more accurate picture of where important taxpayer funded innovation is happening in America. Here are two examples from two different patents:
APPLICANT: U.S. Army Research Laboratory, Adelphi, MD
ASSIGNEE: The United States of America as represented by the Secretary of the Army Washington, DC
APPLICANT: Optech Ventures, LLC (Torrance, California)
ASSIGNEE(S): The Regents of the University of California (Oakland, California); Optech Ventures, LLC (Torrance, California)
INVENTOR(S)
The inventors appear in the same order as they appear on the patent. FedInvents presents the names in first name/last name order because they are easier to read than the last name/first name order of the names on the USPTO patent documents.
ABSTRACT
The abstract as it appears on the patent.
FILED
The date of the patent application including the day of the week.
APPL NO
This is the patent application serial number. If you’d like to learn more about how application serial numbers work you can go to the Lists Page.
ART UNIT
Patent data includes the Art Unit where a patent was examined. (The Art Unit isn’t available for published patent applications.) The Art Unit provides insight into what group of patent examiners prosecuted the patent application and the subject matter that the examiners work on. For example:
3793 — Medical Instruments, Diagnostic Equipment, and Treatment Devices
You can learn more about ART UNITS on the FedInvent Patents Weekly panel called About Tech Center or you can find information on the FedInvent Lists Page.
CURRENT CPC
Current CPC provides a list of the Cooperative Patent Classification symbols assigned to the patent. These are the CPC symbols assigned at the time the patent was granted.
The FedInvent Project is a patent classification maximalist endeavor or put another way, we believe that more you understand about patent classification the more you'll learn about the nature of the invention and the types of work that the federal government is funding.
The symbol presented in BOLD is the symbol identified as the "first" classification which is the most relevant classification on the patent. The date that follows the symbol is the date of the most recent revision to the art classed there.
- A61B 1/149 (20130101)
- A61B 1/71 (20130101)
- A61B 1/105 (20130101)
The CPC symbols match the classifications found on the PDF version of the patent. Over time, the classifications on the full-text version of the patent change to reflect how USPTO organizes patent art to support its examiners. The two sets of CPCs don’t always match.
VIEW PATENT
As of June 2021, we include two ways to view a patent at USPTO. FedInvent provides a link to the Full-Text Version of the patent and a link to the PDF version of the patent.
HOW DO I FIND A SPECIFIC PATENT ON A PAGE?
You can use the Command F or Control F to find a specific patent you are interested in.
HOW DO I GET HERE?
You navigate to the details of a patent by clicking the information icon that follows a patent on the FedInvent Patents Weekly Report.
You can also reach this page using the weekly page link that looks like this:
https://wayfinder.digital/fedinvent/patents-2010/fedinvent-patents-20100810.html
Just update the date portion of the URL. Tuesdays for patents. Thursdays for pre-grant publication of patent applications.
Download a copy of the How To Use This Page