FedInvent™ Patents
Patent Details for Tuesday, April 22, 2014
This page was updated on Monday, March 27, 2023 at 03:59 AM GMT
Department of Health and Human Services (HHS)
| US 08701471 | O'Donnell et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Matthew O'Donnell (Seattle, Washington); Xiaohu Gao (Shoreline, Washington) |
| ASSIGNEE(S) | University of Washington through its Center for Commercialiation (Seattle, Washington) |
| INVENTOR(S) | Matthew O'Donnell (Seattle, Washington); Xiaohu Gao (Shoreline, Washington) |
| ABSTRACT | Method and system for background suppression in magneto-motive photoacoustic imaging of labeled target objects. |
| FILED | Thursday, October 13, 2011 |
| APPL NO | 13/273095 |
| ART UNIT | 2856 — Printing/Measuring and Testing |
| CURRENT CPC | Measuring and testing 073/64.530 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701597 | Maupin et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Gary O. Maupin (Cape Coral, Florida); Marc C. Dolan (Wellington, Colorado); Nicholas Hamon (Sparta, New Jersey); Eric J. Snell (Barnesville, Georgia) |
| ASSIGNEE(S) | Centers for Disease Control and Prevention (Atlanta, Georgia); Bayer Cropscience S.A. (Lyons, France); B and G Equipment Company, Inc. (Jackson, Georgia) |
| INVENTOR(S) | Gary O. Maupin (Cape Coral, Florida); Marc C. Dolan (Wellington, Colorado); Nicholas Hamon (Sparta, New Jersey); Eric J. Snell (Barnesville, Georgia) |
| ABSTRACT | An enclosure is provided having openings for entry of rodents within the enclosure. There is arranged one or more applicators in the form of a suspended flexible web configured to contact rodents entering the chamber and having a chemical on the web for application to the rodents. |
| FILED | Monday, October 03, 2011 |
| APPL NO | 13/252111 |
| ART UNIT | 3644 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Animal husbandry 119/661 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08702629 | Giuffrida et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Joseph P. Giuffrida (Hickley, Ohio); Dustin A. Heldman (Shaker Heights, Ohio); Thomas O. Mera (South Euclid, Ohio) |
| ASSIGNEE(S) | Great Lakes Neuro Technologies Inc. (Cleveland, Ohio) |
| INVENTOR(S) | Joseph P. Giuffrida (Hickley, Ohio); Dustin A. Heldman (Shaker Heights, Ohio); Thomas O. Mera (South Euclid, Ohio) |
| ABSTRACT | The present invention relates to a movement disorder monitor, and a method of measuring the severity of a subject's movement disorder. The present invention additionally relates to a treatment delivery system for treating a subject in response to changes in the severity of a subject's symptoms. The present invention further provides for a system and method, which can accurately quantify symptoms of movement disorders, utilizing continuously obtained kinetic information to be analyzed, accurately distinguishing between symptoms of movement disorders and activities of daily living, relating quantified symptoms to a standard clinical rating scale, and correlating a subject's symptoms with certain physiological and environmental factors. The present invention still further provides for home monitoring of symptoms in subjects with these movement disorders in order to capture the complex fluctuation patterns of the disease over the course of days, weeks, months, or years. |
| FILED | Monday, July 18, 2011 |
| APPL NO | 13/185302 |
| ART UNIT | 3736 — Sheet Container Making, Package Making, Receptacles, Shoes, Apparel, and Tool Driving or Impacting |
| CURRENT CPC | Surgery 6/595 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08702929 | Leburton et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jean-Pierre Leburton (Urbana, Illinois); Gregory Timp (Urbana, Illinois); Maria E. Gracheva (Potsdam, New York); Julien Vidal (Bages, France) |
| ASSIGNEE(S) | The Board of Trustees of the University of Illinois (Urbana, Illinois) |
| INVENTOR(S) | Jean-Pierre Leburton (Urbana, Illinois); Gregory Timp (Urbana, Illinois); Maria E. Gracheva (Potsdam, New York); Julien Vidal (Bages, France) |
| ABSTRACT | A system that incorporates teachings of the present disclosure may include, for example, a solid-state selector having a vessel for carrying a liquid medium with one or more molecules surrounded by ions, a solid state conductive structure doped with impurities having one or more through-holes extending between two surfaces of the solid state conductive structure positioned within the liquid medium of the vessel, a voltage source coupled to the solid state conductive structure to selectively stimulate the ions surrounding the one or more molecules to pass through the one or more through-holes. Additional embodiments are disclosed. |
| FILED | Thursday, March 22, 2012 |
| APPL NO | 13/427442 |
| ART UNIT | 1759 — Tires, Adhesive Bonding, Glass/Paper making, Plastics Shaping & Molding |
| CURRENT CPC | Chemistry: Electrical and wave energy 24/403.10 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08702948 | Ronaghi et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Mostafa Ronaghi (San Diego, California); Tarun Khurana (Stanford, California); Juan G. Santiago (Stanford, California) |
| ASSIGNEE(S) | The Board of Trustees of the Leland Stanford Junior University (Palo Alto, California) |
| INVENTOR(S) | Mostafa Ronaghi (San Diego, California); Tarun Khurana (Stanford, California); Juan G. Santiago (Stanford, California) |
| ABSTRACT | Disclosed are a method and apparatus that use an electric field for improved biological assays. The electric field is applied across a device having wells, which receive reactants, which carry a charge. The device thus uses a controllable voltage source between the first and second electrodes, which is controllable to provide a positive charge and a negative charge to a given electrode. By controlled use of the electric field charged species in a fluid in a fluid channel are directed into or out of the well by an electric field between the electrodes. The present method involves the transport of fluids, as in a microfluidic device, and the electric field-induced movement of reactive species according to various assay procedures, such as DNA sequencing, synthesis or the like. |
| FILED | Friday, September 14, 2012 |
| APPL NO | 13/618228 |
| ART UNIT | 1759 — Tires, Adhesive Bonding, Glass/Paper making, Plastics Shaping & Molding |
| CURRENT CPC | Chemistry: Electrical and wave energy 24/547 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703073 | Gracias et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | David Hugo Gracias (Baltimore, Maryland); Timothy Gar-Ming Leong (Baltimore, Maryland) |
| ASSIGNEE(S) | The Johns Hopkins University (Baltimore, Maryland) |
| INVENTOR(S) | David Hugo Gracias (Baltimore, Maryland); Timothy Gar-Ming Leong (Baltimore, Maryland) |
| ABSTRACT | A lithographically structured device has an actuation layer and a control layer operatively connected to the actuation layer. The actuation layer includes a stress layer and a neutral layer that is constructed of materials and with a structure such that it stores torsional energy upon being constructed. The control layer is constructed to maintain the actuation layer substantially in a first configuration in a local environmental condition and is responsive to a change in the local environmental condition such that it permits a release of stored torsional energy to cause a change in a structural configuration of the lithographically structured device to a second configuration, the control layer thereby providing a trigger mechanism. The lithographically structured device has a maximum dimension that is less than about 10 mm when it is in the second configuration. |
| FILED | Friday, March 06, 2009 |
| APPL NO | 12/864942 |
| ART UNIT | 1779 — Chemical Apparatus, Separation and Purification, Liquid and Gas Contact Apparatus |
| CURRENT CPC | Chemical apparatus and process disinfecting, deodorizing, preserving, or sterilizing 422/550 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703096 | Cai et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Lisheng Cai (Derwood, Maryland); Victor W. Pike (Bethesda, Maryland); Robert B. Innis (Rockville, Maryland) |
| ASSIGNEE(S) | The United States of America as Represented by the Secretary of the Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Lisheng Cai (Derwood, Maryland); Victor W. Pike (Bethesda, Maryland); Robert B. Innis (Rockville, Maryland) |
| ABSTRACT | Novel derivatives of imidazopyridinylbenzeneamines and novel derivatives of benzothiazolylbenzeneamines are disclosed that offer improved behavior when used as imaging agents for positron emission tomography of beta-amyloids. Also disclosed is a palladium-catalyzed reaction scheme under microwave conditions for aryl thioethers in general that provides a high ratio of substitution relative to reduction and can be used for the imidazopyridinylbenzeneamine derivatives as well as other compounds of related structure. |
| FILED | Thursday, April 19, 2007 |
| APPL NO | 12/293340 |
| ART UNIT | 1618 — Organic Compounds: Bio-affecting, Body Treating, Drug Delivery, Steroids, Herbicides, Pesticides, Cosmetics, and Drugs |
| CURRENT CPC | Preparations for Medical, Dental, or Toilet Purposes A61K 51/00 (20130101) Original (OR) Class |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703114 | Satchi-Fainaro et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ronit Satchi-Fainaro (Tel-Aviv, Israel); Ehud Segal (Ramat-Gan, Israel); Jindrich Kopecek (Salt Lake City, Israel); Pavla Kopeckova (Salt Lake City, Utah); Huaizhong Pan (Salt Lake City, Utah) |
| ASSIGNEE(S) | Ramot at Tel-Aviv University Ltd. (Tel-Aviv, Israel); University of Utah Research Foundation (Salt Lake City, Utah) |
| INVENTOR(S) | Ronit Satchi-Fainaro (Tel-Aviv, Israel); Ehud Segal (Ramat-Gan, Israel); Jindrich Kopecek (Salt Lake City, Israel); Pavla Kopeckova (Salt Lake City, Utah); Huaizhong Pan (Salt Lake City, Utah) |
| ABSTRACT | Conjugates of hydroxypropyl methacrylamide (HPMA)-derived copolymers having attached thereto TNP-470 and a high load (e.g., higher than 3 mol %) of alendronate (ALN), and processes of preparing same are disclosed. Conjugates of polymers or copolymers having attached thereto an anti-angiogenesis agent and an oligoaspartate bone targeting agent, and processes of preparing same, are further disclosed. Pharmaceutical compositions containing these conjugates and uses thereof in the treatment and monitoring of bone related disorders are also disclosed. |
| FILED | Thursday, May 21, 2009 |
| APPL NO | 12/993855 |
| ART UNIT | 1618 — Organic Compounds: Bio-affecting, Body Treating, Drug Delivery, Steroids, Herbicides, Pesticides, Cosmetics, and Drugs |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/78.170 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703120 | Martuza et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Robert Martuza (Marblehead, Massachusetts); Samuel Rabkin (Swampscott, Massachusetts); Hiroaki Wakimoto (Newton, Massachusetts); Ryuichi Kanai (Brookline, Massachusetts) |
| ASSIGNEE(S) | The General Hospital Corporation (Boston, Massachusetts) |
| INVENTOR(S) | Robert Martuza (Marblehead, Massachusetts); Samuel Rabkin (Swampscott, Massachusetts); Hiroaki Wakimoto (Newton, Massachusetts); Ryuichi Kanai (Brookline, Massachusetts) |
| ABSTRACT | The invention, in some aspects, relates to the selective killing of cancer stem cells by oncolytic Herpes virus mediated oncolysis. In some aspects, the invention relates to methods for treating a subject having a cancer stem cell by administering to the subject an oncolytic Herpes virus. In other aspects, the invention provides methods for evaluating the efficacy of an oncolytic Herpes virus for killing cancer stem cells. |
| FILED | Monday, May 04, 2009 |
| APPL NO | 12/994960 |
| ART UNIT | 1632 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/93.200 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703128 | Unutmaz et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Derya Unutmaz (New York, New York); Aimee El Hed (Morrisville, North Carolina) |
| ASSIGNEE(S) | New York University (New York, New York) |
| INVENTOR(S) | Derya Unutmaz (New York, New York); Aimee El Hed (Morrisville, North Carolina) |
| ABSTRACT | The present invention provides methods of identifying the presence of or quantifying the amount of one or more of T helper (Th) cells and iTreg cells present in a sample by identifying the presence of an ADAM or the amount of an ADAM, such as ADAM12, present in a sample. The present invention also provides methods for increasing or decreasing signaling of a TGF such as TGFβ by increasing or decreasing the biological activity or expression of an ADAM. Further, the present invention provides methods for inhibiting or stimulating, downregulating or upregulating, an immune response, and for treating diseases associated with an immune response such as cancer, viral, bacterial and fungal infections, autoimmune diseases and graft versus host diseases. Still further, the invention provides screening methods effective for identifying therapeutic agents, pharmaceutical compositions containing therapeutic agents, and vaccines. |
| FILED | Monday, January 23, 2012 |
| APPL NO | 13/355798 |
| ART UNIT | 1646 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/130.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703138 | Wang |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ping Wang (Roslyn, New York) |
| ASSIGNEE(S) | The Feinstein Institute for Medical Research (Manhasset, New York) |
| INVENTOR(S) | Ping Wang (Roslyn, New York) |
| ABSTRACT | Disclosed are pharmaceutical compositions comprising a CIRP inhibitor. A method of treating a subject suffering from an inflammatory condition comprising administering to said subject a CIRP inhibitor is also described herein. |
| FILED | Tuesday, April 13, 2010 |
| APPL NO | 13/264205 |
| ART UNIT | 1647 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/141.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703140 | Holers et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | V. Michael Holers (Denver, Colorado); Joshua M. Thurman (Greenwood Village, Colorado); Christian Taube (Denver, Colorado); Erwin W. Gelfand (Englewood, Colorado); Gary Gilkeson (Charleston, South Carolina) |
| ASSIGNEE(S) | MUSC Foundation for Research Development (Charleston, South Carolina); National Jewish Health (Denver, Colorado); The Regents of the University of Colorado, a body corporate (Denver, Colorado) |
| INVENTOR(S) | V. Michael Holers (Denver, Colorado); Joshua M. Thurman (Greenwood Village, Colorado); Christian Taube (Denver, Colorado); Erwin W. Gelfand (Englewood, Colorado); Gary Gilkeson (Charleston, South Carolina) |
| ABSTRACT | Disclosed are novel inhibitors of the alternative complement pathway and particularly, novel anti-factor B antibodies. Also disclosed is the use of such inhibitors to reduce or prevent airway hyperresponsiveness and/or airway inflammation by selectively inhibiting the alternative complement pathway, thereby treating diseases in which such conditions play a role. Also disclosed is the use of such inhibitors to reduce or prevent other diseases and conditions, including ischemia-reperfusion injury, by inhibition of the alternative complement pathway. |
| FILED | Wednesday, August 22, 2007 |
| APPL NO | 11/843617 |
| ART UNIT | 1644 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/145.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703145 | Yamamoto |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Janet K. Yamamoto (Gainesville, Florida) |
| ASSIGNEE(S) | University of Florida Research Foundation, Inc. (Gainesville, Florida) |
| INVENTOR(S) | Janet K. Yamamoto (Gainesville, Florida) |
| ABSTRACT | The subject invention pertains to methods and compositions for protecting feline animals from infection by FIV using immunogens derived from primate immunodeficiency viruses, including HIV and SIV. Methods for vaccinating feline animals with the subject vaccine compositions are described. Feline animals vaccinated according to the methods and compositions of the subject invention exhibit protective humoral and cellular immune responses to FIV when challenged with FIV. |
| FILED | Wednesday, October 07, 2009 |
| APPL NO | 12/575058 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/188.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703146 | Aderem et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Alan Aderem (Seattle, Washington); Fumitaka Hayashi (Kinnelon, New Jersey); Kelly D. Smith (Seattle, Washington); David M. Underhill (Seattle, Washington); Adrian Ozinsky (Seattle, Washington) |
| ASSIGNEE(S) | Institute for Systems Biology (Seattle, Washington) |
| INVENTOR(S) | Alan Aderem (Seattle, Washington); Fumitaka Hayashi (Kinnelon, New Jersey); Kelly D. Smith (Seattle, Washington); David M. Underhill (Seattle, Washington); Adrian Ozinsky (Seattle, Washington) |
| ABSTRACT | The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:49) or EQAAKTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:50), or a modification thereof. Further provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAE ITQ (SEQ ID NO:44) and substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. Methods of using immunomodulatory flagellin peptides additionally are provided. |
| FILED | Tuesday, November 16, 2004 |
| APPL NO | 10/991347 |
| ART UNIT | 1645 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/190.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703149 | Rice et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Charles Rice (New York, New York); Matthew J. Evans (New York, New York); Thomas Von Hahn (Hamburg, Germany) |
| ASSIGNEE(S) | The Rockefeller University (New York, New York) |
| INVENTOR(S) | Charles Rice (New York, New York); Matthew J. Evans (New York, New York); Thomas Von Hahn (Hamburg, Germany) |
| ABSTRACT | The invention relates to the discovery that the Claudin-1 protein functions as a co-receptor for entry of HCV into cells. Methods of inhibiting, preventing or mitigating HCV infections by inhibiting HCV interactions with Claudin-1 are provided. Methods of identifying agents or compounds that interfere with HCV interactions with Claudin-1 are also provided. Finally, useful kits, cell culture compositions, agents, and compounds related to the inhibition of HCV interactions with Claudin-1 are also disclosed. |
| FILED | Tuesday, August 23, 2011 |
| APPL NO | 13/215820 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/228.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703150 | Leppla et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Stephen H. Leppla (Bethesda, Maryland); Rachel Schneerson (Bethesda, Maryland); John B. Robbins (New York, New York) |
| ASSIGNEE(S) | The United States of America, as Represented by the Secretary, Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Stephen H. Leppla (Bethesda, Maryland); Rachel Schneerson (Bethesda, Maryland); John B. Robbins (New York, New York) |
| ABSTRACT | The invention relates to improved methods of producing and recovering B. anthracis protective antigen (PA), especially modified PA which is protease resistant, and to methods of using of these PAs or nucleic acids encoding these PAs for eliciting an immunogenic response in humans, including responses which provide protection against, or reduce the severity of, B. anthracis bacterial infections and which are useful to prevent and/or treat illnesses caused by B. anthracis, such as inhalation anthrax, cutaneous anthrax and gastrointestinal anthrax. |
| FILED | Friday, September 23, 2011 |
| APPL NO | 13/244060 |
| ART UNIT | 1645 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/246.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703152 | Sun |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jun Sun (Rochester, New York) |
| ASSIGNEE(S) | University of Rochester (Rochester, New York) |
| INVENTOR(S) | Jun Sun (Rochester, New York) |
| ABSTRACT | Methods and products are disclosed for treating an inflammatory intestinal disease in a mammalian subject in need thereof, or preventing or reducing a symptom of inflammatory intestinal disease. These method include administering to the subject a therapeutically effective dose of (i) an isolated AvrA protein or polypeptide fragment thereof or (ii) a nucleic acid molecule encoding the isolated AvrA protein or polypeptide fragment. Preferred inflammatory intestinal diseases include Inflammatory Bowel Disease, Celiac Disease, and gastroenteritis. |
| FILED | Wednesday, June 03, 2009 |
| APPL NO | 12/996166 |
| ART UNIT | 1645 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/258.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703276 | García et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Héctor Alejandro Becerril García (Palo Alto, California); Adam T. Woolley (Orem, Utah) |
| ASSIGNEE(S) | Brigham Young University (Provo, Utah) |
| INVENTOR(S) | Héctor Alejandro Becerril García (Palo Alto, California); Adam T. Woolley (Orem, Utah) |
| ABSTRACT | Nanostructures on substrates include one or more nanofeatures having unscathed walls and width dimensions of forty-five nm or less. The nanofeatures may include at least one of a nanotrench, nanocapillary, nano-chemical pattern, and nanowire. The nanostructures may include a nano object with a pattern of nano elements. A nano system may include at least one nano system device, which may include at least one nanofeature. A method of forming nanofeatures on substrates includes placing a nano-templating element on the substrate. A masking material is deposited at an acute angle to form shadow gaps on shadowed regions of the substrate. The nano-templating element, the angle, and other factors may be selected to form shadow gaps having width dimensions less than 10 nm. The substrate may be chemically modified in the areas corresponding to the shadow gaps to create nanofeatures with unscathed walls having width dimensions of less than 10 nm. |
| FILED | Thursday, July 31, 2008 |
| APPL NO | 12/184131 |
| ART UNIT | 1783 — Miscellaneous Articles, Stock Material |
| CURRENT CPC | Stock material or miscellaneous articles 428/172 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703413 | Daley et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | George Q. Daley (Weston, Massachusetts); In-Hyun Park (Milford, Connecticut); Thorsten M. Schlaeger (Brookline, Massachusetts); Elayne Chan (Auburndale, Massachusetts); Sutheera Ratanasirintrawoot (Cambridge, Massachusetts) |
| ASSIGNEE(S) | Children's Medical Center Corporation (Boston, Massachusetts) |
| INVENTOR(S) | George Q. Daley (Weston, Massachusetts); In-Hyun Park (Milford, Connecticut); Thorsten M. Schlaeger (Brookline, Massachusetts); Elayne Chan (Auburndale, Massachusetts); Sutheera Ratanasirintrawoot (Cambridge, Massachusetts) |
| ABSTRACT | The methods and kits described herein are based, in part, to the discovery phenotype representing a fully-reprogrammed iPS cell and several reprogramming intermediates. The methods and kits described herein permit identification of fully-reprogrammed iPS cells and further permits one of skill in the art to monitor the emergence of iPS cells during the reprogramming process. The methods/kits can also be performed using real time using live cell imaging. Also described herein are methods for screening candidate reprogramming agents by monitoring the emergence of fully-reprogrammed iPS cells in the presence and absence of such an agent. |
| FILED | Tuesday, September 22, 2009 |
| APPL NO | 13/120192 |
| ART UNIT | 1647 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/4 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703436 | Progulske-Fox et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ann Progulske-Fox (Keystone Heights, Florida); Jeffrey Daniel Hillman (Gainesville, Florida); Martin Handfield (Gainesville, Florida) |
| ASSIGNEE(S) | University of Florida Research Foundation (Gainesville, Florida) |
| INVENTOR(S) | Ann Progulske-Fox (Keystone Heights, Florida); Jeffrey Daniel Hillman (Gainesville, Florida); Martin Handfield (Gainesville, Florida) |
| ABSTRACT | The invention provides compositions and methods for the detection of Porphyromonas gingivalis and for the treatment and prevention of diseases and infections caused by P. gingivalis. |
| FILED | Friday, July 18, 2008 |
| APPL NO | 12/175892 |
| ART UNIT | 1645 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/7.320 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703437 | Zhang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Qisheng Zhang (Chapel Hill, North Carolina); Wei Gang Huang (Chapel Hill, North Carolina); John Sondek (Chapel Hill, North Carolina); Stephanie Hicks (Hillsborough, North Carolina) |
| ASSIGNEE(S) | The University of North Carolina at Chapel Hill (Chapel Hill, North Carolina) |
| INVENTOR(S) | Qisheng Zhang (Chapel Hill, North Carolina); Wei Gang Huang (Chapel Hill, North Carolina); John Sondek (Chapel Hill, North Carolina); Stephanie Hicks (Hillsborough, North Carolina) |
| ABSTRACT | The present invention provides fluorogenic substrates and methods of use in detecting and analyzing phospholipase C isozyme (PLC) activity. |
| FILED | Tuesday, June 07, 2011 |
| APPL NO | 13/703274 |
| ART UNIT | 1651 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/19 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703438 | Huang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jing Huang (Los Angeles, California); Brett Eugene Lomenick (Los Angeles, California); Rui Hao (Los Angeles, California); Nao Jonai (Yokohama, Japan); Thomas M. Vondriska (Los Angeles, California); Sarah Warburton (Los Angeles, California); Gregory Joseph Baker (Los Angeles, California); Mariam Aghajan (Los Angeles, California) |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Jing Huang (Los Angeles, California); Brett Eugene Lomenick (Los Angeles, California); Rui Hao (Los Angeles, California); Nao Jonai (Yokohama, Japan); Thomas M. Vondriska (Los Angeles, California); Sarah Warburton (Los Angeles, California); Gregory Joseph Baker (Los Angeles, California); Mariam Aghajan (Los Angeles, California) |
| ABSTRACT | Drug affinity responsive target stability (DARTS) is a method of drug target ID with several significant advantages over current techniques. In certain embodiments the method involves contacting a sample comprising one or more protein target(s) with a test agent to form a sample/test agent mixture; contacting the mixture with a protease; and identifying a protein or protein fragment that is protected from proteolysis, wherein the protection from proteolysis is an indicator that the protein or protein fragment binds to or interacts with the test agent. |
| FILED | Wednesday, November 18, 2009 |
| APPL NO | 12/621290 |
| ART UNIT | 1657 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/23 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703459 | Qasba et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Pradman Qasba (Bethesda, Maryland); Elizabeth Boeggeman (Bethesda, Massachusetts); Boopathy Ramakrishnan (Frederick, Maryland) |
| ASSIGNEE(S) | The United States of America, as represented by the Secretary, Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Pradman Qasba (Bethesda, Maryland); Elizabeth Boeggeman (Bethesda, Massachusetts); Boopathy Ramakrishnan (Frederick, Maryland) |
| ABSTRACT | Disclosed are mutants of galactosyltransferases that can catalyze formation of oligosaccharides in the presence of magnesium; mutants of galactosyltransferases having altered donor and acceptor specificity which can catalyze formation of oligosaccharides in the presence of magnesium; methods and compositions that can be used to synthesize oligosaccharides; methods for increasing the immunogenicity of an antigen; and methods to stabilize platelets. |
| FILED | Monday, December 06, 2004 |
| APPL NO | 10/581942 |
| ART UNIT | 1652 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/193 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703469 | McCray et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Paul McCray (Iowa City, Iowa); Patrick Sinn (Iowa City, Iowa); Gary Blissard (Ithaca, New York) |
| ASSIGNEE(S) | Boyce Thompson Institute for Plant Research (Ithaca, New York); University of Iowa Research Foundation (Iowa City, Iowa) |
| INVENTOR(S) | Paul McCray (Iowa City, Iowa); Patrick Sinn (Iowa City, Iowa); Gary Blissard (Ithaca, New York) |
| ABSTRACT | A method of co-expressing a portion of the VSV G protein gene or a truncated “stem” portion with GP64 and a retrovirus increases the titer of retroviral vectors. A truncated VSV G protein, preferably comprised of a small segment from the C-terminal portion of the ectodomain plus the transmembrane (TM) and cytoplasmic tail (CTD) domains of VSV G, co-expressed with retroviral vectors, enhances the production titers of the retroviral vectors. A preferred embodiment uses a VSV G construct that includes an N-terminal c-Myc epitope plus 42 amino acids from the C-terminal portion of the ectodomain, 20 amino acids from the predicted TM domain, and 29 amino acids from the predicted CTD of the VSV G protein. |
| FILED | Tuesday, September 13, 2011 |
| APPL NO | 13/231324 |
| ART UNIT | 1648 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/235.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703484 | Manson |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Kelledy Manson (Boylston, Massachusetts) |
| ASSIGNEE(S) | The United States of America, as represented by the Secretary, Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Kelledy Manson (Boylston, Massachusetts) |
| ABSTRACT | The invention provides a method for detecting an antigen-specific hematopoietic cell in a biological sample, wherein the method comprises (a) providing a biological sample comprising a hematopoietic cell of a first species; (b) providing a target cell of a second species, wherein the second species is different from the first species, wherein the second species is a macaque species, and wherein the target cell comprises an antigen; (c) contacting the target cell with the sample; and (d) detecting an immune activation marker or activity in the sample, wherein an increase in expression of the immune activation marker or activity in the sample, relative to a control, is an indication that the sample comprises an antigen-specific hematopoietic cell; and wherein a cell identical to the target cell but lacking the antigen does not stimulate expression of the immune activation marker or activity in hematopoietic cells of the first species. |
| FILED | Friday, May 05, 2006 |
| APPL NO | 11/913583 |
| ART UNIT | 1653 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/325 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703496 | Barzilai et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Albert Einstein College of Medicine of Yeshiva University (Bronx, New York) |
| ASSIGNEE(S) | Albert Einstein College of Medicine of Yeshiva University (Bronx, New York) |
| INVENTOR(S) | Nir Barzilai (Hartsdale, New York); Richard B. Lipton (Greenwich, Connecticut) |
| ABSTRACT | This invention provides methods of using of the sizes and levels of high-density lipoprotein (HDL) and low-density lipoprotein (LDL) particles, the −641 allele of the promoter of the gene encoding apolipoprotein C-3 (APOC-3), the 405 allele of the gene encoding cholesteryl ester transfer protein (CETP), and plasma levels of insulin-like growth factor-1 (IGF-1), adiponectin, CETP and APOC-3, for determining and increasing an individual's likelihood of longevity and of retaining cognitive function during aging, and for determining and decreasing an individual's likelihood of developing a cardiovascular-, metabolic- or age-related disease. |
| FILED | Friday, March 15, 2013 |
| APPL NO | 13/832832 |
| ART UNIT | 1656 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Analytical and immunological testing 436/71 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703503 | Melnick et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ari M. Melnick (New York, New York); Jonathan D. Licht (Northbrook, Illinois); Gilbert Privé (Toronto, Canada); Khaja Farid Ahmad (San Francisco, California) |
| ASSIGNEE(S) | Albert Einstein School of Medicine of Yeshiva University (Bronx, New York); Mount Sinai School of Medicine (New York, New York) |
| INVENTOR(S) | Ari M. Melnick (New York, New York); Jonathan D. Licht (Northbrook, Illinois); Gilbert Privé (Toronto, Canada); Khaja Farid Ahmad (San Francisco, California) |
| ABSTRACT | Provided are peptides or mimetics that block corepressor binding to a BCL6 lateral groove. Also provided are methods or blocking corepressor binding to the BCL6 lateral groove. Additionally, methods of inhibiting BCL6 repression in a mammalian cell, and methods of treating a mammal with cancer are provided. |
| FILED | Wednesday, February 23, 2011 |
| APPL NO | 12/932304 |
| ART UNIT | 1675 — Chemical Apparatus, Separation and Purification, Liquid and Gas Contact Apparatus |
| CURRENT CPC | Chemistry: Analytical and immunological testing 436/501 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703652 | Quake et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Stephen R. Quake (Stanford, California); Thomas M. Snyder (Palo Alto, California); Hannah Valantine (Stanford, California) |
| ASSIGNEE(S) | The Board of Trustees of the Leland Stanford Junior University (Palo Alto, California) |
| INVENTOR(S) | Stephen R. Quake (Stanford, California); Thomas M. Snyder (Palo Alto, California); Hannah Valantine (Stanford, California) |
| ABSTRACT | The disclosure provides methods, devices, compositions and kits for diagnosing or predicting transplant status or outcome in a subject who has received a transplant. The methods comprise determining the presence or absence of one or more nucleic acids from a donor transplant, wherein said one or more nucleic acids from said donor are identified based on a predetermined marker profile, and diagnosing or predicting transplant status or outcome based on the presence or absence of said one or more nucleic acids. |
| FILED | Friday, November 05, 2010 |
| APPL NO | 13/508318 |
| ART UNIT | 1639 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Combinatorial chemistry technology: Method, library, apparatus 56/9 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703707 | Sakmar et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Thomas P. Sakmar (New York, New York); Santosh T. Menon (Edgewater, New Jersey); Neeraj Kapoor (New York, New York); Ruchi Gupta (New York, New York); Dan Raleigh (Stony Brook, New York) |
| ASSIGNEE(S) | The Rockefeller University (New York, New York); The Research Foundation of State University of New York (Albany, New York) |
| INVENTOR(S) | Thomas P. Sakmar (New York, New York); Santosh T. Menon (Edgewater, New Jersey); Neeraj Kapoor (New York, New York); Ruchi Gupta (New York, New York); Dan Raleigh (Stony Brook, New York) |
| ABSTRACT | The invention relates to Nucleobindin-1 (NUCB1) protein variants that are capable of disaggregating amyloid fibrils as well as inhibiting the formation of fibrils in the presence of physiological concentrations of calcium. Isolated NUCB1 protein variants, nucleic acids encoding the protein variants, cells comprising the isolated nucleic acids, pharmaceutical compositions and kits comprising the variants, methods of making the variants, and therapeutic uses of the variants are provided. |
| FILED | Thursday, July 16, 2009 |
| APPL NO | 13/054263 |
| ART UNIT | 1654 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/15.400 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703708 | Duffield et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jeremy Duffield (Seattle, Washington); Richard A. Lang (Indian Hill, Ohio) |
| ASSIGNEE(S) | The Brigham and Women's Hospital, Inc. (Boston, Massachusetts); Cincinnati Children's Hospital Medical Center (Cincinnati, Ohio) |
| INVENTOR(S) | Jeremy Duffield (Seattle, Washington); Richard A. Lang (Indian Hill, Ohio) |
| ABSTRACT | Methods of treating solid organ injuries using compounds that enhance Wnt signalling are described. |
| FILED | Thursday, March 18, 2010 |
| APPL NO | 13/256760 |
| ART UNIT | 1647 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/15.400 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703710 | Dzau et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Victor J. Dzau (Durham, North Carolina); Maria Mirotsou (Durham, North Carolina) |
| ASSIGNEE(S) | The Brigham and Women's Hospital, Inc. (Boston, Massachusetts); Duke University (Durham, North Carolina) |
| INVENTOR(S) | Victor J. Dzau (Durham, North Carolina); Maria Mirotsou (Durham, North Carolina) |
| ABSTRACT | A purified paracrine factor of a mesenchymal stem cell, such as a Secreted frizzled related protein (Sfrp) is useful to reduce cell death and/or tissue injury associated with ischemic conditions. |
| FILED | Thursday, March 18, 2010 |
| APPL NO | 12/726468 |
| ART UNIT | 1647 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/16.400 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703712 | Buchsbaum et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Donald J. Buchsbaum (Alabaster, Alabama); Albert F. Lobuglio (Birmingham, Alabama); Tong Zhou (Birmingham, Alabama); Kimberly Foreman (Clarendon Hills, Illinois) |
| ASSIGNEE(S) | The UAB Research Foundation (Birmingham, Alabama) |
| INVENTOR(S) | Donald J. Buchsbaum (Alabaster, Alabama); Albert F. Lobuglio (Birmingham, Alabama); Tong Zhou (Birmingham, Alabama); Kimberly Foreman (Clarendon Hills, Illinois) |
| ABSTRACT | Provided is a method of determining the level of resistance or sensitivity of cancer stem cells to a death receptor agonist. The method includes detecting the level of IAP in one or more DR5/DDX3/IAP complexes in or from the cancer stem cells. Also provided is a method of killing cancer stem cells in a subject and a method of reducing the risk of cancer recurrence in a subject. |
| FILED | Friday, March 18, 2011 |
| APPL NO | 13/634401 |
| ART UNIT | 1647 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/18.900 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703717 | Schellenberger et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Volker Schellenberger (Palo Alto, California); Joshua Silverman (Sunnyvale, California); Chia-wei Wang (Milpitas, California); Willem P. Stemmer (Los Gatos, California); Nathan Geething (Santa Clara, California); Jeffrey L. Cleland (San Carlos, California) |
| ASSIGNEE(S) | Amunix Operating Inc. (Mountain View, California) |
| INVENTOR(S) | Volker Schellenberger (Palo Alto, California); Joshua Silverman (Sunnyvale, California); Chia-wei Wang (Milpitas, California); Willem P. Stemmer (Los Gatos, California); Nathan Geething (Santa Clara, California); Jeffrey L. Cleland (San Carlos, California) |
| ABSTRACT | The present invention relates to compositions comprising growth hormone linked to extended recombinant polypeptide (XTEN), isolated nucleic acids encoding the compositions and vectors and host cells containing the same, and methods of making and using such compositions in treatment of growth hormone-related diseases, disorders, and conditions. |
| FILED | Tuesday, June 08, 2010 |
| APPL NO | 12/796640 |
| ART UNIT | 1654 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/21.200 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703727 | Castor |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Trevor Percival Castor (Arlington, Massachusetts) |
| ASSIGNEE(S) | Aphios Corporation (Woburn, Massachusetts) |
| INVENTOR(S) | Trevor Percival Castor (Arlington, Massachusetts) |
| ABSTRACT | Embodiments of the present invention are directed to articles of manufacture, spheres having a diameter of 50 to 500 nanometers which contain poorly soluble drugs and methods of making such spheres. Embodiments of the present invention have particular application for the following drug candidates and closely related poorly soluble derivatives of such candidates: (i) indole hydrazinecarbothioamide [NSC 73306]; (ii) fenretinide (4HPR) [NSC 374551]; (iii) safingol [NSC 714503]; (iv) 17-allylamino demethoxygeldanamycin (17-AAG) [NSC 330507]; and (v) an aminoflavone drug [NSC 686288]. |
| FILED | Tuesday, August 23, 2011 |
| APPL NO | 13/216125 |
| ART UNIT | 1615 — Organic Compounds: Bio-affecting, Body Treating, Drug Delivery, Steroids, Herbicides, Pesticides, Cosmetics, and Drugs |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/42 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703733 | Wolfe et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | John H. Wolfe (Blue Bell, Pennsylvania); Carlos Gay-Antaki (Philadelphia, Pennsylvania) |
| ASSIGNEE(S) | The Children's Hospital of Philadelphia (Philadelphia, Pennsylvania) |
| INVENTOR(S) | John H. Wolfe (Blue Bell, Pennsylvania); Carlos Gay-Antaki (Philadelphia, Pennsylvania) |
| ABSTRACT | Compositions and methods for treating neurological diseases and disorders are disclosed. |
| FILED | Friday, May 13, 2011 |
| APPL NO | 13/697885 |
| ART UNIT | 1633 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/44.R00 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703734 | Lyakhov et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | The United States of America, as represented by the Secretary, Department of Health and Human Services (Washington, District of Columbia) |
| ASSIGNEE(S) | The United States of America, as represented by the Secretary, Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Ilya G. Lyakhov (Frederick, Maryland); Thomas D. Schneider (Frederick, Maryland); Danielle Needle (Frederick, Maryland) |
| ABSTRACT | The disclosure provides probes for one or more target molecules. In particular examples, the probes include a molecular linker and first and second functional groups linked and spaced by the molecular linker, wherein the functional groups are capable of interacting with one another or with the target biomolecule in a predetermined reaction, and wherein the molecular linker maintains the first and second functional groups sufficiently spaced from one another such that the functional groups do not substantially interact in an absence of the target biomolecule. In the presence of the target biomolecule the functional groups interact (with each other, with the target biomolecule, or both), and in some examples a detectable signal is produced. In some examples, the functional groups can detect or modify a target molecule. Also provided are methods of using the probes, for example to detect or modify a target molecule. |
| FILED | Monday, December 31, 2012 |
| APPL NO | 13/732029 |
| ART UNIT | 1635 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/44 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703769 | Threadgill et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | David Threadgill (Chapel Hill, North Carolina); Cordelia Johnson Barrick (Chapel Hill, North Carolina) |
| ASSIGNEE(S) | The University of North Carolina at Chapel Hill (Chapel Hill, North Carolina) |
| INVENTOR(S) | David Threadgill (Chapel Hill, North Carolina); Cordelia Johnson Barrick (Chapel Hill, North Carolina) |
| ABSTRACT | Methods of treating or preventing obesity or obesity related disorders in a subject are provided, comprising administering to the subject a treatment effective in reducing one or more activities of an epidermal growth factor receptor (EGFR) in the subject. Methods of screening for compositions that can modulate one or more EGFR activities are also provided. |
| FILED | Friday, July 14, 2006 |
| APPL NO | 11/887014 |
| ART UNIT | 1627 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/248 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703799 | Adejare |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Adeboye Adejare (Mantua, New Jersey) |
| ASSIGNEE(S) | |
| INVENTOR(S) | Adeboye Adejare (Mantua, New Jersey) |
| ABSTRACT | Disclosed herein are non-competitive NMDA receptor antagonists having chemical structures similar to that of phencyclidine (PCP). These antagonists contain a polycyclic ring structure in place of the cycloalkyl ring of PCP. The antagonists also differ from PCP in that they include an electron withdrawing group, a hydroxyl group, or an amine group at the para position of the phenyl ring. The antagonists disclosed herein are useful for treating or ameliorating a symptom of ailments associated with over excitation of cells (e.g., neurons) that express NMDA receptors. Examples of ailments that can be treated and for which symptoms can be ameliorated include epilepsy, neurodegenerative disease (e.g., Alzheimer's and Parkinson's diseases), drug addiction, neuropathic pain, and neuronal and glutamate-dependent tumors. |
| FILED | Tuesday, January 31, 2012 |
| APPL NO | 13/361974 |
| ART UNIT | 1629 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/327 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703801 | Nair et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Vasu Nair (Athens, Georgia); Maurice O. Okello (Athens, Georgia); Abdumalik A. Nishonov (Boulder, Colorado); Sanjaykumar Mishra (Pune, India) |
| ASSIGNEE(S) | University of Georgia Research Foundation, Inc. (Athens, Georgia) |
| INVENTOR(S) | Vasu Nair (Athens, Georgia); Maurice O. Okello (Athens, Georgia); Abdumalik A. Nishonov (Boulder, Colorado); Sanjaykumar Mishra (Pune, India) |
| ABSTRACT | New chiral and achiral oxy-substituted cyclopentyl pyridinone diketocarboxamides and their derivatives and methods for their preparations are disclosed. The compounds include tautomers, regioisomers and geometric isomers. These complex carboxamides are designed as inhibitors of HIV replication through inhibition of HIV integrase. The compounds are useful in the prevention or treatment of infection by HIV and in the treatment of AIDS and ARC, either as the compounds, or as pharmaceutically acceptable salts, with pharmaceutically acceptable carriers, used alone or in combination with antivirals, immunomodulators, antibiotics, vaccines, and other therapeutic agents, especially other anti-HIV compounds (including other anti-HIV integrase agents), which can be used to create combination anti-HIV cocktails. Methods of treating AIDS and ARC and methods of treating or preventing infection by HIV are also described. |
| FILED | Tuesday, December 07, 2010 |
| APPL NO | 13/513448 |
| ART UNIT | 1625 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/343 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703815 | Kelly et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jeffery W. Kelly (LaJolla, California); Sungwook Choi (Daejeon, South Korea) |
| ASSIGNEE(S) | The Scripps Research Institute (LaJolla, California) |
| INVENTOR(S) | Jeffery W. Kelly (LaJolla, California); Sungwook Choi (Daejeon, South Korea) |
| ABSTRACT | A family of covalent kinetic stabilizer compounds that selectively and covalently react with the prominent plasma protein transthyretin in preference to more than 4000 other human plasma proteins is disclosed. A contemplated compound corresponds in structure to Formula I, below, where the various substituents are defined within, and reacts chemoselectively with one or two of four Lys-15 ε-amino groups within the transthyretin tetramer. The crystal structure confirms the binding orientation of the compound substructure and the conjugating amide bond. A covalent transthyretin kinetic stabilizer exhibits superior amyloid inhibition potency, compared to a non-covalent counterpart, and inhibits cytotoxicity associated with amyloidogenesis. |
| FILED | Thursday, October 14, 2010 |
| APPL NO | 13/516963 |
| ART UNIT | 1628 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/513 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703826 | Wainer et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Irving W. Wainer (Washington, District of Columbia); Weizhong Zhu (Cockeysville, Maryland); Khalid Chakir (Baltimore, Maryland); Rui Ping Xiao (Baltimore, Maryland); Darrell R. Abernethy (Annapolis, Maryland); Farideh M. Beigi (Baltimore, Maryland) |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Department of Health and Human Services, National Institutes of Health (Washington, District of Columbia) |
| INVENTOR(S) | Irving W. Wainer (Washington, District of Columbia); Weizhong Zhu (Cockeysville, Maryland); Khalid Chakir (Baltimore, Maryland); Rui Ping Xiao (Baltimore, Maryland); Darrell R. Abernethy (Annapolis, Maryland); Farideh M. Beigi (Baltimore, Maryland) |
| ABSTRACT | This disclosure concerns the discovery of (R,R)- and (R,S)-fenoterol analogues which are highly effective at binding β2-adrenergic receptors. Exemplary chemical structures for these analogues are provided. Also provided are pharmaceutical compositions including the disclosed (R,R)-fenoterol and fenoterol analogues, and methods of using such compounds and compositions for the treatment of cardiac disorders such as congestive heart failure and pulmonary disorders such as asthma or chronic obstructive pulmonary disease. |
| FILED | Wednesday, December 21, 2011 |
| APPL NO | 13/333866 |
| ART UNIT | 1628 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/653 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703909 | Reshetnyak et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Yana K. Reshetnyak (South Kingstown, Rhode Island); Oleg A. Andreev (South Kingstown, Rhode Island); Ursula Lehnert (Richmond, United Kingdom); Donald M. Engelman (New Haven, Connecticut) |
| ASSIGNEE(S) | Yale University (New Haven, Connecticut) |
| INVENTOR(S) | Yana K. Reshetnyak (South Kingstown, Rhode Island); Oleg A. Andreev (South Kingstown, Rhode Island); Ursula Lehnert (Richmond, United Kingdom); Donald M. Engelman (New Haven, Connecticut) |
| ABSTRACT | A polypeptide with a predominantly hydrophobic sequence long enough to span a membrane lipid bilayer as a transmembrane helix (TM) and comprising one or more dissociable groups inserts across a membrane spontaneously in a pH-dependant fashion placing one terminus inside cell. The polypeptide conjugated with various functional moieties delivers and accumulates them at cell membrane with low extracellular pH. The functional moiety conjugated with polypeptide terminus placed inside cell are translocated through the cell membrane in cytosol. The peptide and its variants or non-peptide analogs can be used to deliver therapeutic, prophylactic, diagnostic, imaging, gene regulation, cell regulation, or immunologic agents to or inside of cells in vitro or in vivo in tissue at low extracellular pH. |
| FILED | Monday, December 12, 2011 |
| APPL NO | 13/316742 |
| ART UNIT | 1658 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/324 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703920 | Reiter et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Robert E. Reiter (Los Angeles, California); Eric Lepin (Los Angeles, California); Anna M. Wu (Sherman Oaks, California) |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Robert E. Reiter (Los Angeles, California); Eric Lepin (Los Angeles, California); Anna M. Wu (Sherman Oaks, California) |
| ABSTRACT | The present application provides fully human antibodies against N-Cadherin for therapeutic and diagnostic methods in cancer. |
| FILED | Monday, November 09, 2009 |
| APPL NO | 12/590601 |
| ART UNIT | 1643 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/387.300 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703921 | Arya et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Bira Arya (Lutherville, Maryland); Purevdorj Olkhanud (Parkville, Maryland); Juan Espinoza (Los Angeles, California) |
| ASSIGNEE(S) | The United States of America, as represented by the Secretary, Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Bira Arya (Lutherville, Maryland); Purevdorj Olkhanud (Parkville, Maryland); Juan Espinoza (Los Angeles, California) |
| ABSTRACT | The present invention features compositions and methods that make use of complexes comprising one or more inhibitory nucleic acids and a targeting polypeptide, wherein the targeting polypeptide consists of a cell surface receptor ligand. The compositions can be used in methods of silencing gene expression in a cell, in delivering agents to a target cell, and in treating or preventing a disease or disorder in a subject. |
| FILED | Wednesday, April 15, 2009 |
| APPL NO | 12/988148 |
| ART UNIT | 1636 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/402 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703928 | Barany et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Francis Barany (New York, New York); George Barany (Falcon Heights, Minnesota); Robert P. Hammer (Baton Rouge, Louisiana); Maria Kempe (Malmo, Sweden); Herman Blok (Wemeldinge, Netherlands); Monib Zirvi (Monmouth Junction, New Jersey) |
| ASSIGNEE(S) | Cornell Research Foundation, Inc. (Ithaca, New York) |
| INVENTOR(S) | Francis Barany (New York, New York); George Barany (Falcon Heights, Minnesota); Robert P. Hammer (Baton Rouge, Louisiana); Maria Kempe (Malmo, Sweden); Herman Blok (Wemeldinge, Netherlands); Monib Zirvi (Monmouth Junction, New Jersey) |
| ABSTRACT | The present invention describes a method for identifying one or more of a plurality of sequences differing by one or more single base changes, insertions, deletions, or translocations in a plurality of target nucleotide sequences. The method includes a ligation phase, a capture phase, and a detection phase. The ligation phase utilizes a ligation detection reaction between one oligonucleotide probe, which has a target sequence-specific portion and an addressable array-specific portion, and a second oligonucleotide probe, having a target sequence-specific portion and a detectable label. After the ligation phase, the capture phase is carried out by hybridizing the ligated oligonucleotide probes to a solid support with an array of immobilized capture oligonucleotides at least some of which are complementary to the addressable array-specific portion. Following completion of the capture phase, a detection phase is carried out to detect the labels of ligated oligonucleotide probes hybridized to the solid support. |
| FILED | Friday, September 09, 2011 |
| APPL NO | 13/229198 |
| ART UNIT | 1634 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Organic compounds 536/24.300 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703936 | Jewett et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | The Regents of the University of California (Oakland, California) |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | John C. Jewett (Berkeley, California); Carolyn R. Bertozzi (Berkeley, California); Ellen May Sletten (Berkeley, California); Chelsea G. Gordon (Berkeley, California) |
| ABSTRACT | Provided are modified cycloalkyne compounds; and methods of use of such compounds in modifying biomolecules. Embodiments include a cycloaddition reaction that can be carried out under physiological conditions. The cycloaddition reaction involves reacting a modified cycloalkyne with an azide moiety on a target biomolecule, generating a covalently modified biomolecule. The selectivity of the reaction and its compatibility with aqueous environments provide for its application in vivo and in vitro. |
| FILED | Thursday, August 08, 2013 |
| APPL NO | 13/962636 |
| ART UNIT | 1622 — Organic Chemistry |
| CURRENT CPC | Organic compounds 540/451 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703947 | Ghosh |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Arun K. Ghosh (West Lafayette, Indiana) |
| ASSIGNEE(S) | Purdue Research Foundation (West Lafayette, Indiana) |
| INVENTOR(S) | Arun K. Ghosh (West Lafayette, Indiana) |
| ABSTRACT | Described herein are compounds, and pharmaceutical compositions, methods, and uses thereof for treating Alzheimer's disease. |
| FILED | Friday, October 09, 2009 |
| APPL NO | 13/123157 |
| ART UNIT | 1626 — Organic Chemistry |
| CURRENT CPC | Organic compounds 544/367 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703963 | Turos et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Edward Turos (Tampa, Florida); Rajesh Kumar Mishra (Tampa, Florida); Kevin Revell (Almo, Kentucky) |
| ASSIGNEE(S) | University of South Florida (Tampa, Florida) |
| INVENTOR(S) | Edward Turos (Tampa, Florida); Rajesh Kumar Mishra (Tampa, Florida); Kevin Revell (Almo, Kentucky); Cristina M. Coates (Tampa, Florida) |
| ABSTRACT | This invention describes the discovery and synthesis of N-thiolated 2-oxazolidinones as a new class of anti bacterial agents. These compounds can be synthesized from 2-oxazolidinones by Ndeprotection and N-sulfenylation. These new substances were found to exhibit potent anti-bacterial activity, including bacteriostatic properties against Staphylococcus spp., including methicillin resistant Staphylcoccus aureus (MRSA), and Bacillus spp., including Bacillus anthracis. |
| FILED | Friday, February 08, 2008 |
| APPL NO | 12/028460 |
| ART UNIT | 1621 — Organic Chemistry |
| CURRENT CPC | Heterocyclic Compounds C07D 263/26 (20130101) Original (OR) Class |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703965 | Kuhn et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Kevin Kuhn (Pasadena, California); Robert H. Grubbs (South Pasadena, California) |
| ASSIGNEE(S) | Materia, Inc. (Pasadena, California); California Institute of Technology (Pasadena, California) |
| INVENTOR(S) | Kevin Kuhn (Pasadena, California); Robert H. Grubbs (South Pasadena, California) |
| ABSTRACT | Methods for the preparation of saturated imidazolinium salts and related compounds that comprises reaction of formamidines with compounds such as dihaloethane and an optional base are disclosed. Alternatively, the imidazolinium salts and related compounds can be prepared in a one-step process without purification of the formamidine reactant. These methods make it possible to obtain numerous imidazolinium salts and related compounds under solvent-free reaction conditions and in excellent yields. |
| FILED | Monday, November 10, 2008 |
| APPL NO | 12/741568 |
| ART UNIT | 1626 — Organic Chemistry |
| CURRENT CPC | Heterocyclic Compounds C07D 233/06 (20130101) Original (OR) Class |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704169 | Alusta et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Pierre Alusta (Little Rock, Arkansas); Cameron Dorey (Pittsburgh, Pennsylvania); William Ryan Parker (Greers Ferry, Arkansas); Jon G. Wilkes (Little Rock, Arkansas); Dan Buzatu (Benton, Arkansas) |
| ASSIGNEE(S) | The United States of America, as represented by the Secretary, Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Pierre Alusta (Little Rock, Arkansas); Cameron Dorey (Pittsburgh, Pennsylvania); William Ryan Parker (Greers Ferry, Arkansas); Jon G. Wilkes (Little Rock, Arkansas); Dan Buzatu (Benton, Arkansas) |
| ABSTRACT | Disclosed is a mass spectrometer for analyzing a sample that has or is suspected of having microorganisms. The disclosed mass spectrometer has been uniquely configured to include a sample platform which functions as a counter electrode or discharge electrode and a surface to provide the sample to be analyzed. The mass spectrometer also includes an ion source positioned adjacent to the sample platform for ionizing and volatizing molecules within the sample, wherein the sample platform and the ion source are positioned such that during operation of the mass spectrometer an electrical discharge takes place between the ion source and the sample platform. Also disclosed are methods for generating a mass spectrum profile/fingerprint of a sample. The methods include positioning a sample platform having a sample adjacent to an ion source. |
| FILED | Tuesday, October 11, 2011 |
| APPL NO | 13/271182 |
| ART UNIT | 2881 — Optics |
| CURRENT CPC | Radiant energy 250/288 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704515 | Ozarslan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Evren Ozarslan (Bethesda, Maryland); Peter J. Basser (Washington, District of Columbia) |
| ASSIGNEE(S) | The United States of America, as represented by the Secretary, Department of Health and Human Services (Washington, District of Columbia) |
| INVENTOR(S) | Evren Ozarslan (Bethesda, Maryland); Peter J. Basser (Washington, District of Columbia) |
| ABSTRACT | Using pulsed-field-gradient (PFG) sequences, the sizes of the pores in ordered porous media can be estimated from the “diffraction” pattern that the signal attenuation curves exhibit. A different diffraction pattern is observed when the experiment is extended to a larger number (N) of diffusion gradient pulse pairs. Differences in the characteristics of attenuation curves also permit distinguishing different pore shapes and distributions using the N-PFG technique. Using an even number of PFG pairs, an approximation to the average pore size can be obtained even when the sample contains pores with a broad distribution of sizes. Multi-PFG sequences can also be used to differentiate free and multi-compartment diffusion, and to estimate compartment sizes and orientations, and to distinguish microscopic and ensemble anisotropy. |
| FILED | Tuesday, August 11, 2009 |
| APPL NO | 12/539462 |
| ART UNIT | 2866 — Printing/Measuring and Testing |
| CURRENT CPC | Electricity: Measuring and testing 324/309 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705184 | Xu et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Chunhui (Chris) Xu (Ithaca, New York); Watt W. Webb (Ithaca, New York); Douglas S. Scherr (Scarsdale, New York); Dimitre Gueorguiev Ouzounov (Ithaca, New York); David R. Rivera (Ithaca, New York); Christopher M. Brown (Ithaca, New York); Demirhan Kobat (Ithaca, New York); David Huland (Hamburg, Germany); Scott S. Howard (South Bend, Indiana) |
| ASSIGNEE(S) | Cornell University (Ithaca, New York) |
| INVENTOR(S) | Chunhui (Chris) Xu (Ithaca, New York); Watt W. Webb (Ithaca, New York); Douglas S. Scherr (Scarsdale, New York); Dimitre Gueorguiev Ouzounov (Ithaca, New York); David R. Rivera (Ithaca, New York); Christopher M. Brown (Ithaca, New York); Demirhan Kobat (Ithaca, New York); David Huland (Hamburg, Germany); Scott S. Howard (South Bend, Indiana) |
| ABSTRACT | An optical scanner, scanner apparatus, or scanner assembly, which may be particularly advantageous for use in a multiphoton microscope, includes a first drivable bending component, a second drivable bending component mounted perpendicularly to the first component, and at least one optical waveguide coupled one or both of the first and second bending components, wherein the at least one optical waveguide provides both a propagation path for a multiphoton excitation radiation delivery between a light source and a target and a multiphoton-induced emission radiation delivery between the target and a detector. A GRIN relay lens. A multiphoton microscope incorporating the scanner and the GRIN relay lens. |
| FILED | Thursday, December 08, 2011 |
| APPL NO | 13/314478 |
| ART UNIT | 2872 — Optics |
| CURRENT CPC | Optical Elements, Systems, or Apparatus G02B 3/00 (20130101) Original (OR) Class |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705345 | Kamal et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ahmed E. Kamal (Ames, Iowa); Salah A. Aly (Ames, Iowa) |
| ASSIGNEE(S) | Iowa State University Research Foundation, Inc. (Ames, Iowa) |
| INVENTOR(S) | Ahmed E. Kamal (Ames, Iowa); Salah A. Aly (Ames, Iowa) |
| ABSTRACT | A method for protecting against link failures in a communications network having a plurality of paths between senders and receivers is provided. The method includes sending data units by the senders over the communications network on working circuits, applying network coding to form a combination of data units from data units from a plurality of the senders, and sending the combination of data units over the communications network on a backup circuit. If one or more link failures occur in the working circuits resulting in loss of one or more of the data units, then the method further includes recovering the one or more of the data units from the combination of data units transmitted on the backup circuit. The backup circuit used to carry the combination of data units may be implemented in-band with user data or may be implemented as out-of-band backup circuits. |
| FILED | Friday, August 15, 2008 |
| APPL NO | 12/192765 |
| ART UNIT | 2473 — Multiplex and VoIP |
| CURRENT CPC | Multiplex communications 370/217 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705822 | Yu et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Lifeng Yu (Rochester, Minnesota); Cynthia H. McCollough (Byron, Minnesota) |
| ASSIGNEE(S) | MAYO Foundation for Medical Education and Research (Rochester, Minnesota) |
| INVENTOR(S) | Lifeng Yu (Rochester, Minnesota); Cynthia H. McCollough (Byron, Minnesota) |
| ABSTRACT | A system and method for the accurate quantitative evaluation of dual-energy computed tomography (CT) projection data that is acquired in a dual-source helical scan includes employing a dual-source z-axis helical interpolation method. The method includes transforming the two helical projection data sets, where corresponding projections of high- and low-energy data sets are shifted with respect to one another by 90 degrees or another angle, into corresponding non-helical projection data sets. A dual-source helical interpolation algorithm allows for projection space dual-energy processing by realigning the high- and low-energy datasets based on the z-axis interpolation. This algorithm may be implemented using a variety of interpolation schemes and can be extended from single slice to multi-slice data acquisitions. Subsequent to the registration of the non-helical projection data sets, projection space processing allows for accurate material quantification and virtual monochromatic images in which beam hardening artifacts have been substantially suppressed. |
| FILED | Wednesday, September 02, 2009 |
| APPL NO | 13/059579 |
| ART UNIT | 2665 — Image Analysis; Applications; Pattern Recognition; Color and compression; Enhancement and Transformation |
| CURRENT CPC | Image analysis 382/128 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706188 | Koo et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Seungbum Koo (Palo Alto, California); Brian A. Hargreaves (Menlo Park, California); Garry E. Gold (Stanford, California) |
| ASSIGNEE(S) | The Board of Trustees of the Leland Stanford Junior University (Palo Alto, California) |
| INVENTOR(S) | Seungbum Koo (Palo Alto, California); Brian A. Hargreaves (Menlo Park, California); Garry E. Gold (Stanford, California) |
| ABSTRACT | A method for musculoskeletal tissue segmentation used in magnetic resonance imaging (MRI) is provided. MRI image data is collected using at least two different contrast mechanisms. Voxel values from data from each contrast mechanism are used as elements of a feature vector. The feature vector is compared with classification boundaries to classify musculoskeletal tissue type of the voxel. The previous two steps are repeated for a plurality of voxels. An image is generated from the classified musculoskeletal tissue types for the plurality of voxels to provide a musculoskeletal segmentation image. |
| FILED | Wednesday, June 04, 2008 |
| APPL NO | 12/133293 |
| ART UNIT | 3768 — Telecommunications: Analog Radio Telephone; Satellite and Power Control; Transceivers, Measuring and Testing; Bluetooth; Receivers and Transmitters; Equipment Details |
| CURRENT CPC | Surgery 6/410 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706427 | Haque et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Imran Haque (Woodside, California); Vijay Pande (Los Altos, California) |
| ASSIGNEE(S) | The Board of Trustees of the Leland Stanford Junior University (Palo Alto, California) |
| INVENTOR(S) | Imran Haque (Woodside, California); Vijay Pande (Los Altos, California) |
| ABSTRACT | Methods and algorithms are presented that implement linear algebraic techniques for rapidly estimating chemical similarities for several popular measures. The methods of the present invention reflect source similarity measures for both Tanimoto calculation and rank ordering. After a precalculation step on a database, the methods of the present invention afford several orders of magnitude of speedup in database screening. The present invention also provides an asymptotic speedup for large similarity matrix construction problems, reducing the number of conventional slow similarity evaluations required from quadratic to linear scaling. |
| FILED | Saturday, February 26, 2011 |
| APPL NO | 13/035961 |
| ART UNIT | 2865 — Printing/Measuring and Testing |
| CURRENT CPC | Data processing: Measuring, calibrating, or testing 72/32 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Defense (DOD)
| US 08701255 | Cavallaro |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Paul V. Cavallaro (Raynham, Massachusetts) |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | Paul V. Cavallaro (Raynham, Massachusetts) |
| ABSTRACT | Crimp-imbalanced protective fabric is accomplished by varying the levels of yarn crimp within and across a layer or layers of a multi-layer fabric armor system. The method includes developing a crimp in the yarn (utilized for producing a fiber layer) by pulling the yarn through a solution that substantially coats the yarn. The removable coating has a thickness that ensures a proper amount of crimp in the yarn. The tension in the yarn is controlled; the yarn is weaved; and a crimp is applied in the yarn. Once the crimp is applied, families of the crimped yarn are utilized as a layer or layered to produce a soft armor form. |
| FILED | Tuesday, July 30, 2013 |
| APPL NO | 13/954350 |
| ART UNIT | 3765 — SELECT * FROM codes_techcenter; |
| CURRENT CPC | Textiles: Manufacturing 028/168 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701494 | Saxena et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Indu Saxena (Torrance, California); Lothar Kempen (Redondo Beach, California); Chai Tea (El Monte, California) |
| ASSIGNEE(S) | Optech Ventures, LLC (Torrance, California) |
| INVENTOR(S) | Indu Saxena (Torrance, California); Lothar Kempen (Redondo Beach, California); Chai Tea (El Monte, California) |
| ABSTRACT | An apparatus and method for testing composite structures in which ultrasonic waves are used to detect disbonds in the structures are described. The apparatus comprises a flexible structure carrying acousto-optical transducers such as fiber Bragg gratings. During use, the apparatus is mechanically and conformally coupled to the structure under test. |
| FILED | Tuesday, August 07, 2012 |
| APPL NO | 13/569049 |
| ART UNIT | 2856 — Printing/Measuring and Testing |
| CURRENT CPC | Measuring and testing 073/632 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701538 | Marscher et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | William Donnelly Marscher (Morristown, New Jersey); William Joseph Kelly (Montville, New Jersey) |
| ASSIGNEE(S) | Mechanical Solutions, Inc. (Whippany, New Jersey) |
| INVENTOR(S) | William Donnelly Marscher (Morristown, New Jersey); William Joseph Kelly (Montville, New Jersey) |
| ABSTRACT | Multiple embodiments of a system are disclosed for defeating enemy missiles and rockets by the use of a non-lethal cloud of pellets that collide with the missile a certain distance away from the target causing premature detonation of the missile, and/or possible severe damage to the missile, and/or deflection of the missile, and/or a deformation to the ogive cones to cause a short in the fuze circuit, and/or deposition of conductive material to cause a short in the fuze circuit. |
| FILED | Wednesday, November 16, 2011 |
| APPL NO | 13/297457 |
| ART UNIT | 3641 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Ordnance 089/1.110 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701558 | Rastegar et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jahangir S. Rastegar (Stony Brook, New York); Richard T. Murray (Patchogue, New York) |
| ASSIGNEE(S) | Omnitek Partners LLC (Ronkonkoma, New York) |
| INVENTOR(S) | Jahangir S. Rastegar (Stony Brook, New York); Richard T. Murray (Patchogue, New York) |
| ABSTRACT | A device for enabling safe/arm functionality in a gravity dropped weapon detachably connected to an airframe. The device including: an elastic element disposed in a shell of the weapon; a releasable connection between the weapon and the airframe to release a stored and/or generated energy in the elastic element; and a piezoelectric member connected to one end of the elastic member for converting the one or more of the stored and generated energy to an electrical energy. Wherein the releasable connection includes: a link having a movable connection for movement of the link relative to the shell between a first position constraining the elastic element from movement and a second position releasing the elastic member to generate the electrical energy; and a lanyard for tethering the link to the airframe such that the link is moved to the second position upon the weapon being released from the airframe. |
| FILED | Friday, April 26, 2013 |
| APPL NO | 13/871241 |
| ART UNIT | 3641 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Ammunition and explosives 12/207 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701559 | Rastegar et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jahangir S. Rastegar (Stony Brook, New York); Carlos M. Pereira (Tannersville, Pennsylvania); Richard Dratler (Montville, New Jersey) |
| ASSIGNEE(S) | Omnitek Partners LLC (Ronkonkoma, New York) |
| INVENTOR(S) | Jahangir S. Rastegar (Stony Brook, New York); Carlos M. Pereira (Tannersville, Pennsylvania); Richard Dratler (Montville, New Jersey) |
| ABSTRACT | A method for detecting a target impact of the munition. The method including: providing the munition with a power supply having a piezoelectric material for generating power from an axial vibration induced by the munition; monitoring an output from the power supply; and determining if the munition has axially impacted a target based on the output. |
| FILED | Wednesday, January 17, 2007 |
| APPL NO | 11/654289 |
| ART UNIT | 3641 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Ammunition and explosives 12/210 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701877 | Elmasri et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Bishara Elmasri (Landing, New Jersey); Timothy Woo (Flushing, New York); Leon Moy (Montclair, New Jersey) |
| ASSIGNEE(S) | The United States of America as Represented by the Secretary of the Army (Washington, District of Columbia) |
| INVENTOR(S) | Bishara Elmasri (Landing, New Jersey); Timothy Woo (Flushing, New York); Leon Moy (Montclair, New Jersey) |
| ABSTRACT | A storage container for storing a device containing energetic material may include a metal wall. A venting window may be disposed in the metal wall. The venting window may include a plurality of metal supports that define a plurality of openings therebetween. An ionomer material may cover the plurality of openings. The ionomer material may have a melting temperature lower than an ignition temperature of the energetic material in the device. |
| FILED | Thursday, September 29, 2011 |
| APPL NO | 13/248191 |
| ART UNIT | 3728 — Wells, Earth Boring/Moving/Working, Excavating, Mining, Harvesters, Bridges, Roads, Petroleum, Closures, Connections, and Hardware |
| CURRENT CPC | Special receptacle or package 26/3 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701953 | Bopp et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jayson K. Bopp (Fishers, Indiana); Sarah L. Palmer (New Palestine, Indiana) |
| ASSIGNEE(S) | Raytheon Company (Waltham, Massachusetts) |
| INVENTOR(S) | Jayson K. Bopp (Fishers, Indiana); Sarah L. Palmer (New Palestine, Indiana) |
| ABSTRACT | According to one embodiment, an electronic flight bag mounting system a cockpit mounting member coupled to an electronic flight bag mounting member. The cockpit mounting member is configured to mount to a cockpit of an aircraft, while the electronic flight bag mounting member is configured to be coupled to an electronic flight bag. The electronic flight bag mounting member is movable from a deployed position in which a display of the electronic flight bag faces a cockpit seat configured in the cockpit to a storage position in which the electronic flight bag faces away from the cockpit seat. |
| FILED | Friday, October 09, 2009 |
| APPL NO | 12/576780 |
| ART UNIT | 3782 — Wells, Earth Boring/Moving/Working, Excavating, Mining, Harvesters, Bridges, Roads, Petroleum, Closures, Connections, and Hardware |
| CURRENT CPC | Package and article carriers 224/547 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08702439 | Paulsel et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Roger Q Paulsel (Weatherford, Texas); Donald W. Murray (Arlington, Texas); Michael A. Parvaresh (Austin, Texas) |
| ASSIGNEE(S) | WilliamsRDM, Inc. (Fort Worth, Texas) |
| INVENTOR(S) | Roger Q Paulsel (Weatherford, Texas); Donald W. Murray (Arlington, Texas); Michael A. Parvaresh (Austin, Texas) |
| ABSTRACT | Electrical connectors suitable for wet environments and even underwater mating are provided. A replaceable gel filled cartridge affixes over sockets of a female plug. Water channels and radial holes in the receptacle combine to form a pathway for water ejection during connection formation. A coupling nut secures the female plug to the male connector. A spring housed within the coupling nut allows the coupling nut to further rotate, after pins are seated in respective sockets, to seal water holes. The cartridge is filled with hydrophobic gel and has a diaphragm sandwiched between a front and a rear housing. Contact pins pass through the diaphragm and pass through the gel filled rear housing before mating with respective sockets. Trapping of water is minimized with the escape of water via channels in the receptacle. Contaminated or lost gel is readily replaced via the cartridge affording multiple wet-mateable connections for a given connector. |
| FILED | Thursday, July 14, 2011 |
| APPL NO | 13/182812 |
| ART UNIT | 2833 — Electrical Circuits and Systems |
| CURRENT CPC | Electrical connectors 439/271 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703022 | Svoboda et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Vojtech Svoboda (Huntsville, Alabama); Jianjun Wei (Huntsville, Alabama); Sameer Singhal (Huntsville, Alabama) |
| ASSIGNEE(S) | CFD Research Corporation (Huntsville, Alabama) |
| INVENTOR(S) | Vojtech Svoboda (Huntsville, Alabama); Jianjun Wei (Huntsville, Alabama); Sameer Singhal (Huntsville, Alabama) |
| ABSTRACT | The present disclosure provides an aqueous based electrically conductive ink, which is essentially solvent free and includes a nano-scale conducting material; a binding agent; and an enzyme. In one embodiment, the ink includes at least one of a mediator, a cross-linking agent and a substrate as well. In one further embodiment, the present disclosure provides electrically conductive ink including a single walled, carboxylic acid functionalized carbon nanotube; 1-Ethyl-3-[3-dimethylaminopropyl]carbodiimide hydrochloride and N-hydroxy succinimide (NHS) ester; polyethyleneimine; an aqueous buffer; and glucose oxidase. |
| FILED | Wednesday, June 08, 2011 |
| APPL NO | 13/155811 |
| ART UNIT | 1766 — Organic Chemistry, Polymers, Compositions |
| CURRENT CPC | Compositions 252/500 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703090 | Tour et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | James M. Tour (Bellaire, Texas); Dmitry V. Kosynkin (Houston, Texas); Amanda Higginbotham (Los Alamos, New Mexico); Brandi Katherine Price (Houston, Texas) |
| ASSIGNEE(S) | William Marsh Rice University (Houston, Texas) |
| INVENTOR(S) | James M. Tour (Bellaire, Texas); Dmitry V. Kosynkin (Houston, Texas); Amanda Higginbotham (Los Alamos, New Mexico); Brandi Katherine Price (Houston, Texas) |
| ABSTRACT | Methods for producing macroscopic quantities of oxidized graphene nanoribbons are disclosed herein. The methods include providing a plurality of carbon nanotubes and reacting the plurality of carbon nanotubes with at least one oxidant to form oxidized graphene nanoribbons. The at least one oxidant is operable to longitudinally open the carbon nanotubes. In some embodiments, the reacting step takes place in the presence of at least one acid. In some embodiments, the reacting step takes place in the presence of at least one protective agent. Various embodiments of the present disclosure also include methods for producing reduced graphene nanoribbons by reacting oxidized graphene nanoribbons with at least one reducing agent. Oxidized graphene nanoribbons, reduced graphene nanoribbons and compositions and articles derived therefrom are also disclosed herein. |
| FILED | Wednesday, August 19, 2009 |
| APPL NO | 12/544017 |
| ART UNIT | 1732 — Metallurgy, Metal Working, Inorganic Chemistry, Catalyst, Electrophotography, Photolithography |
| CURRENT CPC | Chemistry of inorganic compounds 423/447.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703258 | Shamberger |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Patrick Shamberger (Centerville, Ohio) |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Air Force (Washington, District of Columbia) |
| INVENTOR(S) | Patrick Shamberger (Centerville, Ohio) |
| ABSTRACT | The present invention describes a nucleating agent tailored specifically to the thermal energy storage medium lithium nitrate trihydrate (LiNO3-3H2O), and to the use thereof. Addition of the nucleating agent copper hydroxy nitrate hydrate [Cu3(OH)5(NO3)-2H2O](Likasite) suppresses the undercooling in lithium nitrate trihydrate, forming a superior composite thermal energy storage medium. |
| FILED | Monday, January 30, 2012 |
| APPL NO | 13/361028 |
| ART UNIT | 1782 — Miscellaneous Articles, Stock Material |
| CURRENT CPC | Stock material or miscellaneous articles 428/34.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703278 | Weber |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Mark W. Weber (Zimmeman, Minnesota) |
| ASSIGNEE(S) | Honeywell International Inc. (Morristown, New Jersey) |
| INVENTOR(S) | Mark W. Weber (Zimmeman, Minnesota) |
| ABSTRACT | A light weight printed wiring board that is particularly well suited for high-G and/or other weight sensitive applications is provided. In one illustrative embodiment, a light weight PWB is provided that includes a substrate having one or more layers extending generally parallel to a plane. To help reduce the weight of the PWB, the substrate may have or define one or more lighter weight regions. In some cases, the one or more lighter weight regions may consume greater than 25%, 30%, 40%, 50%, 60%, 75% or more of the overall volume of the substrate, and thus the weight of the substrate may be reduced by greater than 25%, 30%, 40%, 50%, 60%, 75% or more. |
| FILED | Tuesday, March 28, 2006 |
| APPL NO | 11/277668 |
| ART UNIT | 1783 — Miscellaneous Articles, Stock Material |
| CURRENT CPC | Stock material or miscellaneous articles 428/201 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703285 | Blaiszik et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Benjamin J. Blaiszik (Urbana, Illinois); Jericho L. Moll (Urbana, Illinois); Brett A. Beiermann (Champaign, Illinois); Scott R. White (Champaign, Illinois); Nancy R. Sottos (Champaign, Illinois) |
| ASSIGNEE(S) | The Board of Trustees of the University of Illinois (Urbana, Illinois) |
| INVENTOR(S) | Benjamin J. Blaiszik (Urbana, Illinois); Jericho L. Moll (Urbana, Illinois); Brett A. Beiermann (Champaign, Illinois); Scott R. White (Champaign, Illinois); Nancy R. Sottos (Champaign, Illinois) |
| ABSTRACT | A reinforced composite material includes a solid polymer matrix, a reinforcing material in the solid polymer matrix, and a first plurality of capsules. The reinforcing material includes a surface. The capsules are on the surface of the reinforcing material, and include a liquid healing agent. The amount of the healing agent of the capsules is at least 0.01 milligrams per square centimeter of the surface area of the reinforcing material. |
| FILED | Tuesday, August 18, 2009 |
| APPL NO | 12/543206 |
| ART UNIT | 1785 — Miscellaneous Articles, Stock Material |
| CURRENT CPC | Stock material or miscellaneous articles 428/321.500 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703319 | Aston et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Richard W. Aston (Brea, California); Michael John Langmack (Huntington Beach, California) |
| ASSIGNEE(S) | The Boeing Company (Chicago, Illinois) |
| INVENTOR(S) | Richard W. Aston (Brea, California); Michael John Langmack (Huntington Beach, California) |
| ABSTRACT | An apparatus comprises a first plurality of walls, a second plurality of walls, and a plurality of channels formed by the first plurality of walls and the second plurality of walls. The second plurality of walls meets the first plurality of walls at substantially right angles and forms a housing with a first side and a second side. The plurality of channels extends through the housing from the first side to the second side. The plurality of channels has a first plurality of openings on the first side. The plurality of channels has a second plurality of openings on the second side. The plurality of channels has substantially a same shape and is configured to receive a plurality of battery cells. |
| FILED | Monday, February 01, 2010 |
| APPL NO | 12/697696 |
| ART UNIT | 1726 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Chemistry: Electrical current producing apparatus, product, and process 429/120 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703355 | Zhang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Chun Zhang (Tallahassee, Florida); Wei Zhu (Tallahassee, Florida); Jian-ping Zheng (Tallahassee, Florida); Zhiyong Liang (Tallahassee, Florida); Ben Wang (Tallahassee, Florida) |
| ASSIGNEE(S) | Florida State University Research Foundation, Inc. (Tallahassee, Florida) |
| INVENTOR(S) | Chun Zhang (Tallahassee, Florida); Wei Zhu (Tallahassee, Florida); Jian-ping Zheng (Tallahassee, Florida); Zhiyong Liang (Tallahassee, Florida); Ben Wang (Tallahassee, Florida) |
| ABSTRACT | A membrane electrode assembly (MEA) for a fuel cell comprising a gradient catalyst structure and a method of making the same. The gradient catalyst structure can include a plurality of catalyst nanoparticles, e.g., platinum, disposed on layered buckypaper. The layered buckypaper can include at least a first layer and a second layer and the first layer can have a lower porosity compared to the second layer. The gradient catalyst structure can include single-wall nanotubes, carbon nanofibers, or both in the first layer of the layered buckypaper and can include carbon nanofibers in the second layer of the layered buckypaper. The MEA can have a catalyst utilization efficiency of at least 0.35 gcat/kW or less. |
| FILED | Monday, July 19, 2010 |
| APPL NO | 12/839124 |
| ART UNIT | 1724 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Chemistry: Electrical current producing apparatus, product, and process 429/483 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703458 | Heller et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Abbott Diabetes Care Inc. (Alameda, California) |
| ASSIGNEE(S) | Abbott Diabetes Care Inc. (Aladema, California) |
| INVENTOR(S) | Adam Heller (Austin, Texas); Benjamin J. Feldman (Oakland, California); Nicolas Mano (Austin, Texas); Yueh-Lin Loo (Lawrenceville, New Jersey) |
| ABSTRACT | A polymer matrix that may coated on an electrode is created by co-crosslinking (1) an adduct of a polyaniline formed by templated oxidative polymerization on a polymer acid; (2) a water-soluble crosslinker; and (3) a redox enzyme. The polymer matrix may be hydrated, and the absorbed water may make it permeable to, for example, glucose. The polyaniline may be polyaniline itself or a substituted polyaniline; the water-soluble crosslinker may be poly(ethylene glycol) diglycidyl ether, and the redox enzyme may be glucose oxidase. The polymer matrix may be produced by co-crosslinking (1) an adduct of an electrically conductive polymer and a polymer acid; (2) a water-soluble crosslinker; and (3) a redox enzyme in a single step at an about neutral pH, curing by drying. After hydration, the crosslinked polymer matrix may form a 3-dimensional glucose-permeable bioelectrocatalyst, catalyzing the electrooxidation of glucose. |
| FILED | Thursday, January 31, 2013 |
| APPL NO | 13/756009 |
| ART UNIT | 1657 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Molecular biology and microbiology 435/182 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703623 | Chung et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jinwook Chung (Cambridge, Massachusetts); Han Wang (Cambridge, Massachusetts); Tomas Palacios (Cambridge, Massachusetts) |
| ASSIGNEE(S) | Massachusetts Institute of Technology (Cambridge, Massachusetts) |
| INVENTOR(S) | Jinwook Chung (Cambridge, Massachusetts); Han Wang (Cambridge, Massachusetts); Tomas Palacios (Cambridge, Massachusetts) |
| ABSTRACT | A semiconductor arrangement is provided that includes one or more substrate structures. One or more nitride-based material structures are used in fabricating nitride-based devices. One or more intermediary layers are interposed between the one or more substrate structures and the one or more nitride-based material structures. The one or more intermediary layers support the lattice mismatch and thermal expansion coefficients between the one or more nitride-based material structure and the one or more substrate structures. Several new electronic devices based on this arrangement are described. |
| FILED | Monday, June 01, 2009 |
| APPL NO | 12/475740 |
| ART UNIT | 2813 — Semiconductors/Memory |
| CURRENT CPC | Semiconductor device manufacturing: Process 438/763 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703634 | Baker et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Sarah Baker (Santa Barbara, California); April Sawvel (Santa Barbara, California); Galen D. Stucky (Santa Barbara, California) |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Sarah Baker (Santa Barbara, California); April Sawvel (Santa Barbara, California); Galen D. Stucky (Santa Barbara, California) |
| ABSTRACT | Hemostatic compositions comprising a wet layered clay (e.g., wet kaolin) and, optionally, a zeolite, as well as devices and methods of use to promote blood clotting, are provided. |
| FILED | Wednesday, February 13, 2008 |
| APPL NO | 12/030779 |
| ART UNIT | 1617 — Organic Compounds: Bio-affecting, Body Treating, Drug Delivery, Steroids, Herbicides, Pesticides, Cosmetics, and Drugs |
| CURRENT CPC | Compositions: Ceramic 51/141 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703665 | Branson et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Blake T. Branson (Irving, Texas); Charles M. Lukehart (Nashville, Tennessee); Jim L. Davidson (Brentwood, Tennessee) |
| ASSIGNEE(S) | Vanderbilt University (Nashville, Tennessee) |
| INVENTOR(S) | Blake T. Branson (Irving, Texas); Charles M. Lukehart (Nashville, Tennessee); Jim L. Davidson (Brentwood, Tennessee) |
| ABSTRACT | Heat-transfer fluids and lubricating fluids comprising deaggregated diamond nanoparticles are described herein. Also described are composites comprising deaggregated diamond nanoparticles, and methods of making such composites. Method of using deaggregated diamond nanoparticles, for example, to improve the properties of materials such as thermal conductivity and lubricity are also disclosed. |
| FILED | Wednesday, January 12, 2011 |
| APPL NO | 13/005295 |
| ART UNIT | 1771 — Chemical Apparatus, Separation and Purification, Liquid and Gas Contact Apparatus |
| CURRENT CPC | Solid anti-friction devices, materials therefor, lubricant or separant compositions for moving solid surfaces, and miscellaneous mineral oil compositions 58/113 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703762 | Albuquerque et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Edson X. Albuquerque (Baltimore, Maryland); Michael Adler (Bel Air, Maryland); Edna F.R. Pereira (Baltimore, Maryland) |
| ASSIGNEE(S) | University of Maryland Baltimore (Baltimore, Maryland); The United States of America as repr. by the Sec. of the Army, U.S. Army Med. Resr. Inst. of Chem. Defense (Washington, District of Columbia) |
| INVENTOR(S) | Edson X. Albuquerque (Baltimore, Maryland); Michael Adler (Bel Air, Maryland); Edna F.R. Pereira (Baltimore, Maryland) |
| ABSTRACT | A method for treating organophosphorous poisoning (OP) comprising administering to a mammal at risk for OP poisoning an OP poisoning-inhibiting amount of galantamine. |
| FILED | Monday, February 14, 2011 |
| APPL NO | 13/027129 |
| ART UNIT | 1629 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/215 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703842 | Chen et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ming-Yung Chen (Beavercreek, Ohio); Chenggang Chen (Beavercreek, Ohio) |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Air Force (Washington, District of Columbia) |
| INVENTOR(S) | Ming-Yung Chen (Beavercreek, Ohio); Chenggang Chen (Beavercreek, Ohio) |
| ABSTRACT | Light-weight hybrid materials with significantly-reduced coefficient of thermal expansion, low density, and high durability in the aggressive environment such as low-earth orbit are disclosed. The high performance polymer materials can include epoxy, cyanoester, bismalmeide, polyimide, vinylester, polyamide, polyacrylate, and others; with their applications as matrix in the carbon fiber-reinforced or glass fiber-reinforced composite. The fillers for the hybrid include one or two or all, of the following components: the layered-silicate, negative-CTE powder, and low-density material. |
| FILED | Thursday, July 28, 2011 |
| APPL NO | 13/192966 |
| ART UNIT | 1762 — Organic Chemistry, Polymers, Compositions |
| CURRENT CPC | Synthetic resins or natural rubbers 523/219 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703909 | Reshetnyak et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Yana K. Reshetnyak (South Kingstown, Rhode Island); Oleg A. Andreev (South Kingstown, Rhode Island); Ursula Lehnert (Richmond, United Kingdom); Donald M. Engelman (New Haven, Connecticut) |
| ASSIGNEE(S) | Yale University (New Haven, Connecticut) |
| INVENTOR(S) | Yana K. Reshetnyak (South Kingstown, Rhode Island); Oleg A. Andreev (South Kingstown, Rhode Island); Ursula Lehnert (Richmond, United Kingdom); Donald M. Engelman (New Haven, Connecticut) |
| ABSTRACT | A polypeptide with a predominantly hydrophobic sequence long enough to span a membrane lipid bilayer as a transmembrane helix (TM) and comprising one or more dissociable groups inserts across a membrane spontaneously in a pH-dependant fashion placing one terminus inside cell. The polypeptide conjugated with various functional moieties delivers and accumulates them at cell membrane with low extracellular pH. The functional moiety conjugated with polypeptide terminus placed inside cell are translocated through the cell membrane in cytosol. The peptide and its variants or non-peptide analogs can be used to deliver therapeutic, prophylactic, diagnostic, imaging, gene regulation, cell regulation, or immunologic agents to or inside of cells in vitro or in vivo in tissue at low extracellular pH. |
| FILED | Monday, December 12, 2011 |
| APPL NO | 13/316742 |
| ART UNIT | 1658 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/324 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704144 | Elliott et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | James M. Elliott (Santa Maria, California); Mark Alan Massie (Santa Ynez, California) |
| ASSIGNEE(S) | Teledyne Scientific and Imaging, LLC (Thousand Oaks, California) |
| INVENTOR(S) | James M. Elliott (Santa Maria, California); Mark Alan Massie (Santa Ynez, California) |
| ABSTRACT | A dual speed Read-Out Integrated Circuit employs a native pixel array with associated high resolution integration circuits for each pixel and a superpixel array created within the native pixel array by combination of native pixels for charge sharing integration in reduced resolution integration circuits simultaneously with the integration of the high resolution integration circuits. Switching control for readout of the high resolution integration circuits is accomplished at a first frame rate and switching control for readout of the reduced resolution integration circuits is accomplished at a second higher frame rate. |
| FILED | Thursday, October 27, 2011 |
| APPL NO | 13/282762 |
| ART UNIT | 2878 — Optics |
| CURRENT CPC | Radiant energy 250/208.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704179 | Talghader |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Joseph J. Talghader (Edina, Minnesota) |
| ASSIGNEE(S) | Regents of the University of Minnesota (St. Paul, Minnesota) |
| INVENTOR(S) | Joseph J. Talghader (Edina, Minnesota) |
| ABSTRACT | The present invention provides thermal detectors having an optical cavity that is optimized to couple light into a sensor. Light that is on resonance is coupled with the sensor with as high as 100% efficiency, while light off resonance is substantially reflected away. Light that strikes the sensor from the sides (i.e. not on the optical cavity axis) only interacts minimally with sensor because of the reduced absorption characteristics of the sensor. Narrowband sensors in accordance with the present invention can gain as much as 100% of the signal from one direction and spectral band, while receiving only a fraction of the normal radiation noise, which originates from all spectral bands and directions. |
| FILED | Thursday, March 18, 2010 |
| APPL NO | 12/726776 |
| ART UNIT | 2884 — Optics |
| CURRENT CPC | Radiant energy 250/338.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704198 | Kaertner et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Franz X. Kaertner (Newton, Massachusetts); Edilson L. Falcao-Filho (Recife, Brazil); Chien-Jen Lai (Cambridge, Massachusetts); Kyung-Han Hong (Lexington, Massachusetts); Tso Yee Fan (Belmont, Massachusetts) |
| ASSIGNEE(S) | Massachusetts Institute of Technology (Cambridge, Massachusetts) |
| INVENTOR(S) | Franz X. Kaertner (Newton, Massachusetts); Edilson L. Falcao-Filho (Recife, Brazil); Chien-Jen Lai (Cambridge, Massachusetts); Kyung-Han Hong (Lexington, Massachusetts); Tso Yee Fan (Belmont, Massachusetts) |
| ABSTRACT | Extreme ultraviolet radiation is generated based on high-order harmonic generation. First, a driver pulse is generated from a drive laser. Second, the infrared driver pulse is passed through a second harmonic generator with an output wavelength in the range from 400 to 700 nm. Third, the pulse is then passed through a gas medium, which can be inside a resonant cavity, to generate a high-order harmonic in the form of extreme ultraviolet radiation. |
| FILED | Monday, December 13, 2010 |
| APPL NO | 12/966574 |
| ART UNIT | 2881 — Optics |
| CURRENT CPC | Radiant energy 250/504.R00 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704204 | Spanier et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jonathan E. Spanier (Bala Cynwyd, Pennsylvania); Stephen S. Nonnenmann (Philadelphia, Pennsylvania); Oren David Leaffer (Philadelphia, Pennsylvania) |
| ASSIGNEE(S) | Drexel University (Philadelphia, Pennsylvania) |
| INVENTOR(S) | Jonathan E. Spanier (Bala Cynwyd, Pennsylvania); Stephen S. Nonnenmann (Philadelphia, Pennsylvania); Oren David Leaffer (Philadelphia, Pennsylvania) |
| ABSTRACT | Disclosed herein are nanoscale devices comprising one or more ferroelectric nanoshells characterized as having an extreme curvature in at least one spatial dimension. Also disclosed are ferroelectric field effect transistors and metal ferroelectric metal capacitors comprising one or more ferroelectric nanoshells. Methods for controlling spontaneous ferroelectric polarization in nanoshell devices are also disclosed. |
| FILED | Wednesday, December 02, 2009 |
| APPL NO | 13/131994 |
| ART UNIT | 2895 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/4 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704209 | Choi |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Kwong-Kit Choi (Brookeville, Maryland) |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Army (Washington, District of Columbia) |
| INVENTOR(S) | Kwong-Kit Choi (Brookeville, Maryland) |
| ABSTRACT | An infrared photodetector comprising: a thin contact layer substantially transparent to infrared light; an absorption layer positioned such that light admitted through the substantially transparent thin contact area passes through the absorption layer; the absorption layer being configured to utilize resonance to increase absorption efficiency; at least one reflective side wall adjacent to the absorption layer being substantially non-parallel to the incident light operating to reflect light into the absorption layer for absorption of infrared radiation; and a top contact layer positioned adjacent to the active layer. A method of designing a photodetector comprising selecting a type of material based upon the wavelength range to be detected; determining a configuration geometry; calculating the electromagnetic field distributions using a computer simulated design of the configuration geometry, and determining a quantum efficiency spectrum at the desired wavelength or wavelength range; whereby the effectiveness of the photodetector is simulated prior to fabrication. |
| FILED | Thursday, September 22, 2011 |
| APPL NO | 13/240125 |
| ART UNIT | 2896 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/14 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704211 | Kim et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Tae Won Kim (Clifton Park, New York); Min Yan (Ballston Lake, New York); Christian Maria Anton Heller (Albany, New York); Marc Schaepkens (Medina, Ohio); Thomas Bert Gorczyca (Schenectady, New York); Paul Alan McConnelee (Schenectady, New York); Ahmet Gun Erlat (Clifton Park, New York) |
| ASSIGNEE(S) | General Electric Company (Schenectady, New York) |
| INVENTOR(S) | Tae Won Kim (Clifton Park, New York); Min Yan (Ballston Lake, New York); Christian Maria Anton Heller (Albany, New York); Marc Schaepkens (Medina, Ohio); Thomas Bert Gorczyca (Schenectady, New York); Paul Alan McConnelee (Schenectady, New York); Ahmet Gun Erlat (Clifton Park, New York) |
| ABSTRACT | A composite article with at least one high integrity protective coating, the high integrity protective coating having at least one planarizing layer and at least one organic-inorganic composition barrier coating layer. A method for depositing a high integrity protective coating. |
| FILED | Monday, November 15, 2004 |
| APPL NO | 10/988481 |
| ART UNIT | 2812 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/40 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704314 | Bozler |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Carl O. Bozler (Waltham, Massachusetts) |
| ASSIGNEE(S) | Massachusetts Institute of Technology (Cambridge, Massachusetts) |
| INVENTOR(S) | Carl O. Bozler (Waltham, Massachusetts) |
| ABSTRACT | A mechanical memory transistor includes a substrate having formed thereon a source region and a drain region. An oxide is formed upon a portion of the source region and upon a portion of the drain region. A pull up electrode is positioned above the substrate such that a gap is formed between the pull up electrode and the substrate. A movable gate has a first position and a second position. The movable gate is located in the gap between the pull up electrode and the substrate. The movable gate is in contact with the pull up electrode when the movable gate is in a first position and is in contact with the oxide to form a gate region when the movable gate is in the second position. The movable gate, in conjunction with the source region and the drain region and when the movable gate is in the second position, form a transistor that can be utilized as a non-volatile memory element. |
| FILED | Thursday, December 06, 2007 |
| APPL NO | 11/951535 |
| ART UNIT | 2822 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/415 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704315 | Parpia et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jeevak M. Parpia (Ithaca, New York); Harold G. Craighead (Ithaca, New York); Joshua D. Cross (Ithaca, New York); Bojan Robert Ilic (Ithaca, New York); Maxim K. Zalalutdinov (Silver Spring, Maryland); Jeffrey W. Baldwin (Alexandria, Virginia); Brian H. Houston (Fairfax, Virginia) |
| ASSIGNEE(S) | Cornell University (Ithaca, New York) |
| INVENTOR(S) | Jeevak M. Parpia (Ithaca, New York); Harold G. Craighead (Ithaca, New York); Joshua D. Cross (Ithaca, New York); Bojan Robert Ilic (Ithaca, New York); Maxim K. Zalalutdinov (Silver Spring, Maryland); Jeffrey W. Baldwin (Alexandria, Virginia); Brian H. Houston (Fairfax, Virginia) |
| ABSTRACT | The present invention is directed to a CMOS integrated micromechanical device fabricated in accordance with a standard CMOS foundry fabrication process. The standard CMOS foundry fabrication process is characterized by a predetermined layer map and a predetermined set of fabrication rules. The device includes a semiconductor substrate formed or provided in accordance with the predetermined layer map and the predetermined set of fabrication rules. A MEMS resonator device is fabricated in accordance with the predetermined layer map and the predetermined set of fabrication rules. The MEMS resonator device includes a micromechanical resonator structure having a surface area greater than or equal to approximately 20 square microns. At least one CMOS circuit is coupled to the MEMS resonator member. The at least one CMOS circuit is also fabricated in accordance with the predetermined layer map and the predetermined set of fabrication rules. |
| FILED | Friday, June 26, 2009 |
| APPL NO | 13/000650 |
| ART UNIT | 2892 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/415 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704316 | Nguyen et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Clark Tu-Cuong Nguyen (Oakland, California); Li-Wen Hung (Berkeley, California) |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Clark Tu-Cuong Nguyen (Oakland, California); Li-Wen Hung (Berkeley, California) |
| ABSTRACT | Etchant-free methods of producing a gap between two materials are provided. Aspects of the methods include providing a structure comprising a first material and a second material, and subjecting the structure to conditions sufficient to cause a decrease in the volume of at least a portion of at least one of the first material and the second material to produce a gap between the first material and the second material. Also provided are devices produced by the methods (e.g., MEMS and NEMS devices), structures used in the methods and methods of making such structures. |
| FILED | Friday, May 25, 2012 |
| APPL NO | 13/481672 |
| ART UNIT | 2815 — Semiconductors/Memory |
| CURRENT CPC | Microstructural Devices or Systems, e.g Micromechanical Devices B81B 2201/0235 (20130101) B81B 2203/0118 (20130101) Measuring Linear or Angular Speed, Acceleration, Deceleration, or Shock; Indicating Presence, Absence, or Direction, of Movement G01P 15/125 (20130101) G01P 15/0802 (20130101) Electric Switches; Relays; Selectors; Emergency Protective Devices H01H 59/0009 (20130101) Original (OR) Class |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704319 | Tang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Xueti Tang (Fremont, California); Vladimir Nikitin (Campbell, California); Dmytro Apalkov (San Jose, California); Kiseok Moon (Pleasanton, California); Steven M. Watts (Mountain View, California) |
| ASSIGNEE(S) | Samsung Electronics Co., Ltd. (Gyeonggi-Do, South Korea) |
| INVENTOR(S) | Xueti Tang (Fremont, California); Vladimir Nikitin (Campbell, California); Dmytro Apalkov (San Jose, California); Kiseok Moon (Pleasanton, California); Steven M. Watts (Mountain View, California) |
| ABSTRACT | A method and system provide a magnetic junction usable in a magnetic device. The magnetic junction includes a pinned layer, a nonmagnetic spacer layer, a free layer, and at least one damping reduction layer. The free layer has an intrinsic damping constant. The nonmagnetic spacer layer is between the pinned layer and the free layer. The at least one damping reduction layer is adjacent to at least a portion of the free layer and configured to reduce the intrinsic damping constant of the free layer. The magnetic junction is configured such that the free layer is switchable between a plurality of stable magnetic states when a write current is passed through the magnetic junction. |
| FILED | Tuesday, December 20, 2011 |
| APPL NO | 13/332328 |
| ART UNIT | 2815 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/421 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704348 | Webster et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Dean C. Webster (Fargo, North Dakota); Zhigang Chen (Dublin, Ohio) |
| ASSIGNEE(S) | NDSU Research Foundation (Fargo, North Dakota) |
| INVENTOR(S) | Dean C. Webster (Fargo, North Dakota); Zhigang Chen (Dublin, Ohio) |
| ABSTRACT | Disclosed are photo sensitizers that include a polyol moiety covalently bonded to a fused aromatic moiety. Also disclosed is a method for improving UV laser ablation performance of a coating, such as a cationic UV curable coating, by incorporating an oxalyl-containing additive into the cationic UV curable or other coating. Oxalyl-containing sensitizers having the formula Q-O—C(O)—C(O)—O—R1 wherein Q represents a fused aromatic moiety and R1 is an alkyl or aryl group, are also disclosed, as are oxalyl-containing oxetane resins, oxalyl-containing polyester polyols, and cationic UV curable coating formulations that include oxalyl-containing additives. |
| FILED | Friday, April 19, 2013 |
| APPL NO | 13/866480 |
| ART UNIT | 1722 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Active solid-state devices 257/678 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704351 | Gibson et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | David Gibson (San Jose, California); Andy Stavros (San Jose, California) |
| ASSIGNEE(S) | Tessera, Inc. (San Jose, California) |
| INVENTOR(S) | David Gibson (San Jose, California); Andy Stavros (San Jose, California) |
| ABSTRACT | A microelectronic assembly includes units superposed on one another to form at least one stack having a vertical direction. Each unit includes one or more microelectronic devices and has top and bottom surfaces. Top unit terminals are exposed at the top surfaces and bottom unit terminals are exposed at the bottom surfaces. The top and bottom unit terminals are provided at a set of ordered column positions. Each top unit terminal of the set, except the top unit terminals at the highest ordered column position, is connected to a respective bottom unit terminal of the same unit at a next higher ordered column position. Each bottom unit terminal of the set, except the bottom unit terminals of the lowest unit in the stack, is connected to a respective upper unit terminal of the next lower unit in the stack at the same column position. |
| FILED | Tuesday, September 01, 2009 |
| APPL NO | 12/551807 |
| ART UNIT | 2897 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/686 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704537 | Hazeghi et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Arash Hazeghi (San Francisco, California); Joseph A. Sulpizio (Humble, Texas); David J. K. Goldhaber (Palo Alto, California); H. S. Philip Wong (Stanford, California) |
| ASSIGNEE(S) | The Board of Trustees of the Leland Stanford Junior University (Palo Alto, California) |
| INVENTOR(S) | Arash Hazeghi (San Francisco, California); Joseph A. Sulpizio (Humble, Texas); David J. K. Goldhaber (Palo Alto, California); H. S. Philip Wong (Stanford, California) |
| ABSTRACT | The present approach is based on the use of an integrated capacitance bridge circuit to measure the capacitance of a device under test. A significant feature of this approach is that the operating point is not the null point of the bridge circuit. Instead, the operating point of the bridge circuit is tuned to be away from the null point. By moving away from the null point, the output signal from the bridge circuit is increased. Preferably, this output signal is substantially larger than the input noise floor of an amplifier connected to the bridge circuit output, while being substantially less than GνDUT, where G is the gain provided by the bridge circuit transistor and νDUT is the AC signal applied to the device under test. Experiments on graphene devices and on carbon nanotube FETs demonstrate about 10 aF resolution (graphene) and about 13 aF resolution (carbon nanotube FET) at room temperature. |
| FILED | Tuesday, September 27, 2011 |
| APPL NO | 13/200701 |
| ART UNIT | 2868 — Printing/Measuring and Testing |
| CURRENT CPC | Electricity: Measuring and testing 324/680 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704566 | Ainspan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Herschel A. Ainspan (New Hempstead, New York); Mark A. Ferriss (Tarrytown, New York); Daniel J. Friedman (Sleepy Hollow, New York); Alexander V. Rylyakov (Mount Kisco, New York); Jose A. Tierno (Stamford, Connecticut) |
| ASSIGNEE(S) | International Business Machines Corporation (Armonk, New York) |
| INVENTOR(S) | Herschel A. Ainspan (New Hempstead, New York); Mark A. Ferriss (Tarrytown, New York); Daniel J. Friedman (Sleepy Hollow, New York); Alexander V. Rylyakov (Mount Kisco, New York); Jose A. Tierno (Stamford, Connecticut) |
| ABSTRACT | Phase locked loop (PLL) architectures are provided such as hybrid PLL architectures having separate digital integrating control paths and analog proportional control paths. An analog proportional control path can be implemented with a charge pump circuit that includes resistors in series with CMOS switches to generate control currents (e.g., Up/Down control currents) which are used to adjust a control voltage applied to a digitally controlled oscillator. A digital integrating control path can be implemented with a series of sigma-delta modulators that operate at different frequencies to convert higher bit data signals to lower bit data signals along the digital integrating control path. A single phase frequency detector may be implemented to generate control signals that separately control the analog proportional and digital integrating control paths. |
| FILED | Monday, September 10, 2012 |
| APPL NO | 13/608277 |
| ART UNIT | 2842 — Electrical Circuits and Systems |
| CURRENT CPC | Miscellaneous active electrical nonlinear devices, circuits, and systems 327/158 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704567 | Ainspan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Herschel A. Ainspan (New Hempstead, New York); Mark A. Ferriss (Tarrytown, New York); Daniel J. Friedman (Sleepy Hollow, New York); Alexander V. Rylyakov (Mount Kisco, New York); Jose A. Tierno (Stamford, Connecticut) |
| ASSIGNEE(S) | International Business Machines Corporation (Armonk, New York) |
| INVENTOR(S) | Herschel A. Ainspan (New Hempstead, New York); Mark A. Ferriss (Tarrytown, New York); Daniel J. Friedman (Sleepy Hollow, New York); Alexander V. Rylyakov (Mount Kisco, New York); Jose A. Tierno (Stamford, Connecticut) |
| ABSTRACT | Phase locked loop (PLL) architectures are provided such as hybrid PLL architectures having separate digital integrating control paths and analog proportional control paths. An analog proportional control path can be implemented with a charge pump circuit that includes resistors in series with CMOS switches to generate control currents (e.g., Up/Down control currents) which are used to adjust a control voltage applied to a digitally controlled oscillator. A digital integrating control path can be implemented with a series of sigma-delta modulators that operate at different frequencies to convert higher bit data signals to lower bit data signals along the digital integrating control path. A single phase frequency detector may be implemented to generate control signals that separately control the analog proportional and digital integrating control paths. |
| FILED | Wednesday, September 12, 2012 |
| APPL NO | 13/611008 |
| ART UNIT | 2842 — Electrical Circuits and Systems |
| CURRENT CPC | Miscellaneous active electrical nonlinear devices, circuits, and systems 327/158 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704616 | Piazza et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | The Regents of the University of California (Oakland, California) |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Gianluca Piazza (Philadelphia, Pennsylvania); Philip J. Stephanou (Berkeley, California); Albert P. Pisano (Danville, California) |
| ABSTRACT | A contour mode micromechanical piezoelectric resonator. The resonator has a bottom electrode; a top electrode; and a piezoelectric layer disposed between the bottom electrode and the top electrode. The piezoelectric resonator has a planar surface with a cantilevered periphery, dimensioned to undergo in-plane lateral displacement at the periphery. The resonator also includes means for applying an alternating electric field across the thickness of the piezoelectric resonator. The electric field is configured to cause the resonator to have a contour mode in-plane lateral displacement that is substantially in the plane of the planar surface of the resonator, wherein the fundamental frequency for the displacement of the piezoelectric resonator is set in part lithographically by the planar dimension of the bottom electrode, the top electrode or the piezoelectric layer. |
| FILED | Friday, October 26, 2012 |
| APPL NO | 13/662340 |
| ART UNIT | 2843 — Electrical Circuits and Systems |
| CURRENT CPC | Wave transmission lines and networks 333/186 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704891 | Burch et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jason F. Burch (Loogootee, Indiana); Michael E. Zimmer (Springville, Indiana) |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | Jason F. Burch (Loogootee, Indiana); Michael E. Zimmer (Springville, Indiana) |
| ABSTRACT | An electro-optic display unit is disclosed. The electro-optic unit may be mountable to an exterior of a vehicle and may be rotatable about a single axis of rotation. |
| FILED | Wednesday, December 23, 2009 |
| APPL NO | 12/646133 |
| ART UNIT | 2444 — Computer Networks |
| CURRENT CPC | Television 348/148 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705032 | Herzinger et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Craig M. Herzinger (Lincoln, Nebraska); Mathias M. Schubert (Lincoln, Nebraska); Tino Hofmann (Lincoln, Nebraska); Martin M. Liphardt (Lincoln, Nebraska); John A. Woollam (Lincoln, Nebraska) |
| ASSIGNEE(S) | J.A. Woollam Co., Inc (Lincoln, Nebraska) |
| INVENTOR(S) | Craig M. Herzinger (Lincoln, Nebraska); Mathias M. Schubert (Lincoln, Nebraska); Tino Hofmann (Lincoln, Nebraska); Martin M. Liphardt (Lincoln, Nebraska); John A. Woollam (Lincoln, Nebraska) |
| ABSTRACT | The present invention relates to ellipsometer and polarimeter systems, and more particularly is an ellipsometer or polarimeter or the like system which operates in a frequency range between 300 GHz or lower and extending to higher than at least 1 Tera-hertz (THz), and preferably through the Infra-red (IR) range up to, and higher than 100 THz, including: a source such as a backward wave oscillator; a Smith-Purcell cell; a free electron laser, or an FTIR source and a solid state device; and a detector such as a Golay cell; a bolometer or a solid state detector; and preferably including a polarization state generator comprising: an odd bounce image rotating system and a polarizer, or two polarizers; and optionally including least one compensator and/or modulator, in addition to an analyzer. |
| FILED | Thursday, March 07, 2013 |
| APPL NO | 13/815487 |
| ART UNIT | 2886 — Optics |
| CURRENT CPC | Optics: Measuring and testing 356/364 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705041 | Eckman et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ryan Elliot Eckman (Columbus, Minnesota); Peter David Koudelka (St. Paul, Minnesota); Lubomir Koudelka (Shoreview, Minnesota) |
| ASSIGNEE(S) | Promet International, Inc. (Shoreview, Minnesota) |
| INVENTOR(S) | Ryan Elliot Eckman (Columbus, Minnesota); Peter David Koudelka (St. Paul, Minnesota); Lubomir Koudelka (Shoreview, Minnesota) |
| ABSTRACT | An optical probe has optical components of an interferometer and includes an optical axis, at least one optical source for emitting light along an illumination path that is at least partially coaxial with the optical axis, a first beam splitter and a first lens. The first beam splitter intersects the optical axis and splits the light from the at least one optical source into a first beam for traveling along a reference path that is coaxial with the optical axis to a reference surface and a second beam for traveling along a test path that is coaxial with the optical axis to a specimen. The first lens is interposed along the reference path. |
| FILED | Friday, May 20, 2011 |
| APPL NO | 13/112143 |
| ART UNIT | 2877 — Optics |
| CURRENT CPC | Optics: Measuring and testing 356/450 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705166 | Savage-Leuchs |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Lockheed Martin Corporation (Bethesda, Maryland) |
| ASSIGNEE(S) | Lockheed Martin Corporation (Bethesda, Maryland) |
| INVENTOR(S) | Matthias P. Savage-Leuchs (Woodinville, Washington) |
| ABSTRACT | Apparatus and method for amplifying laser signals using segments of fibers of differing core diameters and/or differing cladding diameters to suppress amplified spontaneous emission and non-linear effects such as four-wave mixing (FWM), self-phase modulation, and stimulated Brillouin and/or Raman scattering (SBS/SRS). In some embodiments, different core sizes have different sideband spacings (spacing between the desired signal and wavelength-shifted lobes). Changing core sizes and providing phase mismatches prevent buildup of non-linear effects. Some embodiments further include a bandpass filter to remove signal other than the desired signal wavelength and/or a time gate to remove signal at times other than during the desired signal pulse. Some embodiments include photonic-crystal structures to define the core for the signal and/or the inner cladding for the pump. Some embodiments include an inner glass cladding to confine the signal in the core and an outer glass cladding to confine pump light in the inner cladding. |
| FILED | Thursday, December 27, 2012 |
| APPL NO | 13/729018 |
| ART UNIT | 3645 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Optical: Systems and elements 359/341.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705604 | Goodman et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Joel I. Goodman (Chelmsford, Massachusetts); Benjamin A. Miller (Cambridge, Massachusetts); Matthew A. Herman (Boston, Massachusetts); James Edwin Vian (Westford, Massachusetts) |
| ASSIGNEE(S) | Massachusetts Institute of Technology (Cambridge, Massachusetts) |
| INVENTOR(S) | Joel I. Goodman (Chelmsford, Massachusetts); Benjamin A. Miller (Cambridge, Massachusetts); Matthew A. Herman (Boston, Massachusetts); James Edwin Vian (Westford, Massachusetts) |
| ABSTRACT | Complex polyphase nonlinear equalizer (cpNLEQs) mitigate nonlinear distortions generated by complex in-phase/quadrature (I/Q) time-interleaved analog-to-digital converters (TIADCs). Example cpNLEQs upsample the digital waveform emitted by the TIADC, e.g., by a factor of two, then separate the upsampled digital waveform into upsampled in-phase and quadrature components. Processors in the cpNLEQs create real and imaginary nonlinear compensation terms from the upsampled in-phase and quadrature components. The nonlinear compensation terms are downsampled, and the downsampled imaginary nonlinear compensation term is phase-shifted, then combined with the downsampled real component to produce an estimated residual distortion. Subtracting the estimated residual distortion from the digital waveform emitted by the TIADC yields an equalized digital waveform suitable for further processing. |
| FILED | Wednesday, December 08, 2010 |
| APPL NO | 12/963128 |
| ART UNIT | 2631 — Digital Communications |
| CURRENT CPC | Pulse or digital communications 375/232 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705857 | Livingston et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Mark Alan Livingston (Alexandria, Virginia); Caelan Reed Garrett (Fairfax, Virginia) |
| ASSIGNEE(S) | The United States of America, as represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | Mark Alan Livingston (Alexandria, Virginia); Caelan Reed Garrett (Fairfax, Virginia) |
| ABSTRACT | An image processing system and method corrects the perceptual quality of an image by adjusting the image colors. “Color” in this sense is to be understood as encompassing three-dimensional parameterizations of color, incorporating both intensity and hue. These measurements are made using creative computations developed and adapted from the RETINEX™ theory (Land, 1977), where the RETINEX implementation adjusts any pixel in any direction in color space and further to automatically determine the best direction for it to be adjusted to increase the perceptual visibility of the algorithm with a minimal amount of change to the original image values. |
| FILED | Friday, August 10, 2012 |
| APPL NO | 13/572198 |
| ART UNIT | 2665 — Image Analysis; Applications; Pattern Recognition; Color and compression; Enhancement and Transformation |
| CURRENT CPC | Image analysis 382/167 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706033 | Blanton et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Robin Blanton (Grosse Ile, Michigan); Roger Leon Van Elslander (Warren, Michigan); Anthony B. Vink (Plymouth Township, Michigan); Mark P. Zachos (West Bloomfield, Michigan) |
| ASSIGNEE(S) | Dearborn Group Technology (Farmington Hills, Michigan) |
| INVENTOR(S) | Robin Blanton (Grosse Ile, Michigan); Roger Leon Van Elslander (Warren, Michigan); Anthony B. Vink (Plymouth Township, Michigan); Mark P. Zachos (West Bloomfield, Michigan) |
| ABSTRACT | An adapter for providing wireless communication between a transducer and a computer. The adapter of the present invention includes a processor and a first connector operable for connecting the adapter to the transducer. The connector is in electrical communication with the processor such that the processor receives at least one measured parameter from the transducer. The present invention also includes at least one radio transmitter in electrical communication with the processor, the processor operable to transfer the measured parameter to the at least one radio transmitter for wirelessly transmitting the measured parameter to the computer. The radio transmitter is able to broadcast in one or more wireless communication protocols. The adapter of the present invention is suitable for operation with any type of transducer that functions as a sensor/detector, an actuator, or the like, and is able to transfer the measured parameter detected by the transducer wirelessly to a computer. |
| FILED | Tuesday, August 17, 2010 |
| APPL NO | 12/806592 |
| ART UNIT | 2649 — Telecommunications: Analog Radio Telephone; Satellite and Power Control; Transceivers, Measuring and Testing; Bluetooth; Receivers and Transmitters; Equipment Details |
| CURRENT CPC | Telecommunications 455/41.200 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706052 | Frade et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Richard S. Frade (Lakeville, Massachusetts); Kenneth White (Wakefield, Rhode Island) |
| ASSIGNEE(S) | The United States of America as represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | Richard S. Frade (Lakeville, Massachusetts); Kenneth White (Wakefield, Rhode Island) |
| ABSTRACT | A portable wideband harmonic signal generator includes circuitry for generating a signal having a selected fundamental frequency, for producing a signal having a harmonic series of the selected fundamental frequency, for transferring the signal having the harmonic series using a balanced impedance output, and for directionally transmitting transferred signal having the harmonic series using a directional antenna having a characteristic impedance that is matched to the balanced impedance output. There is thus provided a compact, efficient transmitter and antenna assembly for transmitting a wideband signal. |
| FILED | Friday, June 24, 2011 |
| APPL NO | 13/167935 |
| ART UNIT | 2649 — Telecommunications: Analog Radio Telephone; Satellite and Power Control; Transceivers, Measuring and Testing; Bluetooth; Receivers and Transmitters; Equipment Details |
| CURRENT CPC | Telecommunications 455/76 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706471 | Narayanan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Shrikanth Narayanan (Santa Monica, California); Panayiotis Georgiou (La Crescenta, California) |
| ASSIGNEE(S) | University of Southern California (Los Angeles, California) |
| INVENTOR(S) | Shrikanth Narayanan (Santa Monica, California); Panayiotis Georgiou (La Crescenta, California) |
| ABSTRACT | A translation between a source language and a target language is disclosed. The source language items are divided, with primary and secondary source language items or named entities being identified, where the primary and secondary source languages being different from each other and from the target language. The entities in the second source language are translated in a different way. For example, they may be copied into the target language, or translated in a special way that is based on their meaning, e.g, into a term that has a more descriptive meaning in the target language. |
| FILED | Friday, May 18, 2007 |
| APPL NO | 11/750926 |
| ART UNIT | 2657 — Linguistics, Speech Processing and Audio Compression |
| CURRENT CPC | Electric Digital Data Processing G06F 17/289 (20130101) Original (OR) Class Speech Analysis or Synthesis; Speech Recognition; Speech or Voice Processing; Speech or Audio Coding or Decoding G10L 15/22 (20130101) |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706474 | Blume et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Matthias Blume (San Diego, California); Dayne B. Freitag (La Mesa, California); Zhiqiang Wang (San Diego, California) |
| ASSIGNEE(S) | Fair Isaac Corporation (San Jose, California) |
| INVENTOR(S) | Matthias Blume (San Diego, California); Dayne B. Freitag (La Mesa, California); Zhiqiang Wang (San Diego, California) |
| ABSTRACT | Methods and apparatus, including computer program products, related to entity name translation. In general, a set of data records including one or more names of one or more entities in a source language is received and candidate translations are generated for the names of the data records. The candidate translations are strings of characters in a target language that has a different orthography than an orthography of the source language. A data repository is queried for records matching the candidate translations. A translation of at least one of the candidate translations is selected based on a comparison of a combination of candidate translations and properties of the source record comprising of the publication date, entity name co-occurrence and their frequency with the result of the querying the data repository. |
| FILED | Friday, April 25, 2008 |
| APPL NO | 12/110231 |
| ART UNIT | 2657 — Linguistics, Speech Processing and Audio Compression |
| CURRENT CPC | Electric Digital Data Processing G06F 17/289 (20130101) Original (OR) Class G06F 17/2872 (20130101) |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706729 | Welinder et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | California Institute of Technology (Pasadena, California) |
| ASSIGNEE(S) | California Institute of Technology (Pasadena, California) |
| INVENTOR(S) | Peter Welinder (San Diego, California); Pietro Perona (Altadena, California) |
| ABSTRACT | Systems and methods for distributed data annotation in accordance embodiments of the invention are disclosed. In one embodiment of the invention, a distributed data annotation server system includes a storage device configured to store source data, one or more annotators, annotation tasks and a processor, wherein a distributed data annotation application configures the processor to receive source data including one or more pieces of source data, select one or more annotators, create one or more annotation tasks for the selected annotators and source data, request one or more annotations for the source data using the annotation tasks, receive annotations, determine source data metadata for at least one piece of source data using the received annotations, generate annotator metadata for at least one annotator using the received annotations and the source data, and estimate the ground truth for the source data using the source data metadata and the annotator metadata. |
| FILED | Friday, October 12, 2012 |
| APPL NO | 13/651108 |
| ART UNIT | 2162 — Data Bases & File Management |
| CURRENT CPC | Data processing: Database and file management or data structures 77/736 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706749 | Klaren et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Damian Klaren (San Diego, California); Tracy Castille (San Diego, California) |
| ASSIGNEE(S) | The United States of America as Represented by the Secretary of the Navy (Washington, District of Columbia) |
| INVENTOR(S) | Damian Klaren (San Diego, California); Tracy Castille (San Diego, California) |
| ABSTRACT | A method involves identifying, within each of a plurality of structured data strings within a data file having a serialized data format, each of the plurality of structured data strings contained within an atomic element of an atom within the data file, data particles located within substantially the same location within each structured data string and that match a pre-defined regular expression, and generating a plurality of indexed structured data strings by creating, within each of the plurality of structured data strings, a separate index across all of the plurality of structured data strings for each identified data particle matching a particular pre-defined regular expression. The method may be incorporated into a GUI, where the indexed structured data strings may be displayed to a user and the user may then provide feedback. The user feedback may be a data query, resulting in data that was otherwise not readily searchable. |
| FILED | Wednesday, January 12, 2011 |
| APPL NO | 13/005256 |
| ART UNIT | 2169 — Data Bases & File Management |
| CURRENT CPC | Data processing: Database and file management or data structures 77/760 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706784 | Chou et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | The Aerospace Corporation (El Segundo, California) |
| ASSIGNEE(S) | The Aerospace Corporation (El Segundo, California) |
| INVENTOR(S) | Jason T. Chou (Saint Paul, Minnesota); Todd S. Rose (Redondo Beach, California); Joshua A. Conway (Redondo Beach, California) |
| ABSTRACT | A time domain filter receives a double sideband (DSB) input in the frequency domain and compresses this input into a time domain signal filtered by a time gate for providing a time filtered signal that is then expanded back into the frequency domain as a single sideband (SSB) output with one sideband being filtered by the time gate for translating DSB signals into SSB signals well suited for communicating chirped modulated signals as SSB signals along an electrical line or optical fiber without dispersive nulling of the communicated signal. |
| FILED | Friday, April 12, 2013 |
| APPL NO | 13/862202 |
| ART UNIT | 2193 — Interprocess Communication and Software Development |
| CURRENT CPC | Electrical computers: Arithmetic processing and calculating 78/300 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706794 | Fleizach et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Gregory K. Fleizach (San Diego, California); Ralph W. Hunt (San Marcos, California); Barry R. Hunt (San Diego, California) |
| ASSIGNEE(S) | |
| INVENTOR(S) | Gregory K. Fleizach (San Diego, California); Ralph W. Hunt (San Marcos, California); Barry R. Hunt (San Diego, California) |
| ABSTRACT | A method for processing a digital signal, comprising the following steps: receiving a complex-valued input data array with a processor; converting the complex-valued input data array into a quantized polar domain by approximating magnitude and quantizing the phase data of the input data array with the processor; storing the approximated magnitude in a phase-column indexed matrix in a memory store that is operatively coupled to the processor; processing the input data array with the processor such that all multiplications and summations that would occur during signal processing of the input data array in the Cartesian domain are substituted with circular row shifts and additions of phase-column indexed values in the quantized polar domain; and converting the processed input data array back into the Cartesian domain. |
| FILED | Tuesday, August 23, 2011 |
| APPL NO | 13/216030 |
| ART UNIT | 2193 — Interprocess Communication and Software Development |
| CURRENT CPC | Electrical computers: Arithmetic processing and calculating 78/622 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08707016 | Arimilli et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ravi K. Arimilli (Austin, Texas); Juan C. Rubio (Austin, Texas); Balaram Sinharoy (Poughkeepsie, New York) |
| ASSIGNEE(S) | International Business Machines Corporation (Armonk, New York) |
| INVENTOR(S) | Ravi K. Arimilli (Austin, Texas); Juan C. Rubio (Austin, Texas); Balaram Sinharoy (Poughkeepsie, New York) |
| ABSTRACT | A set of helper thread binaries is created to retrieve data used by a set of main thread binaries. The set of helper thread binaries and the set of main thread binaries are partitioned according to common instruction boundaries. As a first partition in the set of main thread binaries executes within a first core, a second partition in the set of helper thread binaries executes within a second core, thus “warming up” the cache in the second core. When the first partition of the main completes execution, a second partition of the main core moves to the second core, and executes using the warmed up cache in the second core. |
| FILED | Friday, February 01, 2008 |
| APPL NO | 12/024211 |
| ART UNIT | 2183 — Computer Architecture and I/O |
| CURRENT CPC | Electrical computers and digital processing systems: Processing architectures and instruction processing 712/220 |
| VIEW PATENT | @ USPTO: Full Text PDF |
National Science Foundation (NSF)
| US 08701469 | Ober et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Christopher Kemper Ober (Ithaca, New York); Thomas Denis O'Rourke (Ithaca, New York); Michael G. Spencer (Ithaca, New York); James N. Turner (Delmar, New York); Stephen B. Wicker (Ithaca, New York) |
| ASSIGNEE(S) | Cornell University (Ithaca, New York); Health Research, Inc. (Menands, New York) |
| INVENTOR(S) | Christopher Kemper Ober (Ithaca, New York); Thomas Denis O'Rourke (Ithaca, New York); Michael G. Spencer (Ithaca, New York); James N. Turner (Delmar, New York); Stephen B. Wicker (Ithaca, New York) |
| ABSTRACT | A sensor system utilizing flexible electronics for on-line real-time high-sensitivity sampling, monitoring, and analysis of a parameter or analyte of interest in a fluid or in or on a solid is provided. The flexible substrate sensor system comprises a plurality of sensors, a flexible substrate, a network, and a connection between the sensors and the network, wherein the network reads out or collects information from the sensors. The network can be onboard, connected by via a physical connection to the sensors and the flexible substrate, or external to the sensors and flexible substrate, connected via a telemetric or wireless connection to the sensors. The flexible substrate sensor system can be deployed in systems that conduct or distribute fluids or solids, such as distribution systems (municipal water systems, oil or gas pipeline systems), industrial systems (production facilities, piping, and storage systems), and large structures (dams, bridges, walkways, buildings). |
| FILED | Monday, November 19, 2007 |
| APPL NO | 12/515718 |
| ART UNIT | 2856 — Printing/Measuring and Testing |
| CURRENT CPC | Measuring and testing 073/61.410 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701471 | O'Donnell et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Matthew O'Donnell (Seattle, Washington); Xiaohu Gao (Shoreline, Washington) |
| ASSIGNEE(S) | University of Washington through its Center for Commercialiation (Seattle, Washington) |
| INVENTOR(S) | Matthew O'Donnell (Seattle, Washington); Xiaohu Gao (Shoreline, Washington) |
| ABSTRACT | Method and system for background suppression in magneto-motive photoacoustic imaging of labeled target objects. |
| FILED | Thursday, October 13, 2011 |
| APPL NO | 13/273095 |
| ART UNIT | 2856 — Printing/Measuring and Testing |
| CURRENT CPC | Measuring and testing 073/64.530 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701927 | Rubner et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Michael F. Rubner (Westford, Massachusetts); Jacopo Buongiorno (Burlington, Massachusetts); Lin-wen Hu (Lexington, Massachusetts); Eric Christopher Forrest (Berlin, Massachusetts); Erik Howard Williamson (Somerville, Massachusetts); Robert E. Cohen (Jamaica Plain, Massachusetts) |
| ASSIGNEE(S) | Massachusetts Institute of Technology (Cambridge, Massachusetts) |
| INVENTOR(S) | Michael F. Rubner (Westford, Massachusetts); Jacopo Buongiorno (Burlington, Massachusetts); Lin-wen Hu (Lexington, Massachusetts); Eric Christopher Forrest (Berlin, Massachusetts); Erik Howard Williamson (Somerville, Massachusetts); Robert E. Cohen (Jamaica Plain, Massachusetts) |
| ABSTRACT | A superhydrophilic thin film is formed on a metal surface of a boiler vessel to alter the wettability and roughness of the surface, which, in turn, changes the boiling behavior at the surface. The superhydrophilic film is formed by depositing a layer of a first ionic species on the surface from a solution. A second ionic species having a charge opposite to the that of the first ionic species is then deposited from solution onto the surface to produce a bilayer of the first ionic species and the oppositely charged second ionic species. The depositions are then repeated to form a plurality of bilayers, on top of the preceding bilayer. The bilayers are then heated, leaving the second ionic species on the metal surface to form a superhydrophilic film. |
| FILED | Wednesday, February 10, 2010 |
| APPL NO | 12/703228 |
| ART UNIT | 3788 — Wells, Earth Boring/Moving/Working, Excavating, Mining, Harvesters, Bridges, Roads, Petroleum, Closures, Connections, and Hardware |
| CURRENT CPC | Receptacles 220/660 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08702810 | Kennedy et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Joseph P. Kennedy (Akron, Ohio); Gabor Erdodi (Stow, Ohio); Mukerrem Cakmak (Monroe Falls, Ohio); Baris Yalcin (Akron, Ohio); Jungmee Kang (Stow, Ohio) |
| ASSIGNEE(S) | The University of Akron (Akron, Ohio) |
| INVENTOR(S) | Joseph P. Kennedy (Akron, Ohio); Gabor Erdodi (Stow, Ohio); Mukerrem Cakmak (Monroe Falls, Ohio); Baris Yalcin (Akron, Ohio); Jungmee Kang (Stow, Ohio) |
| ABSTRACT | The present invention generally relates to implantable devices for producing insulin in diabetic animals and to methods of making same. Some embodiments include amphiphilic biomembranes for use in biological applications (e.g., as an alternative and/or supplemental insulin source). Some embodiments also include live insulin-producing cells contained within one or more amphiphilic membranes so as to prevent or diminish an immuno-response and/or rejection by the host. |
| FILED | Monday, March 10, 2008 |
| APPL NO | 12/529732 |
| ART UNIT | 1657 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Prosthesis 623/23.640 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08702822 | Bhan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Aditya Bhan (Minneapolis, Minnesota); Michael Tsapatsis (Minneapolis, Minnesota); Lanny D. Schmidt (Minneapolis, Minnesota); Paul J. Dauenhauer (Sunderland, Massachusetts) |
| ASSIGNEE(S) | Regents of the University of Minnesota (St. Paul, Minnesota) |
| INVENTOR(S) | Aditya Bhan (Minneapolis, Minnesota); Michael Tsapatsis (Minneapolis, Minnesota); Lanny D. Schmidt (Minneapolis, Minnesota); Paul J. Dauenhauer (Sunderland, Massachusetts) |
| ABSTRACT | Methods and reactors for producing a fuel are disclosed herein. In some embodiments, the method uses a biomass feedstock and alkane and/or alcohol feedstock, which can be contacted with a metal-containing catalyst to form products including a bio-oil. In some embodiments, oxygen-containing functional groups can be removed from a bio-oil using one or more zeolite thin films. |
| FILED | Monday, August 30, 2010 |
| APPL NO | 12/871187 |
| ART UNIT | 1771 — Chemical Apparatus, Separation and Purification, Liquid and Gas Contact Apparatus |
| CURRENT CPC | Fuel and related compositions 044/605 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08702897 | Lin et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Wei Lin (Atlanta, Georgia); Ching Ping Wong (Berkeley Lake, Georgia) |
| ASSIGNEE(S) | Georgia Tech Research Corporation (Atlanta, Georgia) |
| INVENTOR(S) | Wei Lin (Atlanta, Georgia); Ching Ping Wong (Berkeley Lake, Georgia) |
| ABSTRACT | Embodiments of the present disclosure include structures including a layer of carbon nanotubes, methods of making structures including a layer of carbon nanotubes, and the like. |
| FILED | Wednesday, May 26, 2010 |
| APPL NO | 12/800934 |
| ART UNIT | 1746 — Tires, Adhesive Bonding, Glass/Paper making, Plastics Shaping & Molding |
| CURRENT CPC | Adhesive bonding and miscellaneous chemical manufacture 156/322 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08702929 | Leburton et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Jean-Pierre Leburton (Urbana, Illinois); Gregory Timp (Urbana, Illinois); Maria E. Gracheva (Potsdam, New York); Julien Vidal (Bages, France) |
| ASSIGNEE(S) | The Board of Trustees of the University of Illinois (Urbana, Illinois) |
| INVENTOR(S) | Jean-Pierre Leburton (Urbana, Illinois); Gregory Timp (Urbana, Illinois); Maria E. Gracheva (Potsdam, New York); Julien Vidal (Bages, France) |
| ABSTRACT | A system that incorporates teachings of the present disclosure may include, for example, a solid-state selector having a vessel for carrying a liquid medium with one or more molecules surrounded by ions, a solid state conductive structure doped with impurities having one or more through-holes extending between two surfaces of the solid state conductive structure positioned within the liquid medium of the vessel, a voltage source coupled to the solid state conductive structure to selectively stimulate the ions surrounding the one or more molecules to pass through the one or more through-holes. Additional embodiments are disclosed. |
| FILED | Thursday, March 22, 2012 |
| APPL NO | 13/427442 |
| ART UNIT | 1759 — Tires, Adhesive Bonding, Glass/Paper making, Plastics Shaping & Molding |
| CURRENT CPC | Chemistry: Electrical and wave energy 24/403.10 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703073 | Gracias et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | David Hugo Gracias (Baltimore, Maryland); Timothy Gar-Ming Leong (Baltimore, Maryland) |
| ASSIGNEE(S) | The Johns Hopkins University (Baltimore, Maryland) |
| INVENTOR(S) | David Hugo Gracias (Baltimore, Maryland); Timothy Gar-Ming Leong (Baltimore, Maryland) |
| ABSTRACT | A lithographically structured device has an actuation layer and a control layer operatively connected to the actuation layer. The actuation layer includes a stress layer and a neutral layer that is constructed of materials and with a structure such that it stores torsional energy upon being constructed. The control layer is constructed to maintain the actuation layer substantially in a first configuration in a local environmental condition and is responsive to a change in the local environmental condition such that it permits a release of stored torsional energy to cause a change in a structural configuration of the lithographically structured device to a second configuration, the control layer thereby providing a trigger mechanism. The lithographically structured device has a maximum dimension that is less than about 10 mm when it is in the second configuration. |
| FILED | Friday, March 06, 2009 |
| APPL NO | 12/864942 |
| ART UNIT | 1779 — Chemical Apparatus, Separation and Purification, Liquid and Gas Contact Apparatus |
| CURRENT CPC | Chemical apparatus and process disinfecting, deodorizing, preserving, or sterilizing 422/550 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703285 | Blaiszik et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Benjamin J. Blaiszik (Urbana, Illinois); Jericho L. Moll (Urbana, Illinois); Brett A. Beiermann (Champaign, Illinois); Scott R. White (Champaign, Illinois); Nancy R. Sottos (Champaign, Illinois) |
| ASSIGNEE(S) | The Board of Trustees of the University of Illinois (Urbana, Illinois) |
| INVENTOR(S) | Benjamin J. Blaiszik (Urbana, Illinois); Jericho L. Moll (Urbana, Illinois); Brett A. Beiermann (Champaign, Illinois); Scott R. White (Champaign, Illinois); Nancy R. Sottos (Champaign, Illinois) |
| ABSTRACT | A reinforced composite material includes a solid polymer matrix, a reinforcing material in the solid polymer matrix, and a first plurality of capsules. The reinforcing material includes a surface. The capsules are on the surface of the reinforcing material, and include a liquid healing agent. The amount of the healing agent of the capsules is at least 0.01 milligrams per square centimeter of the surface area of the reinforcing material. |
| FILED | Tuesday, August 18, 2009 |
| APPL NO | 12/543206 |
| ART UNIT | 1785 — Miscellaneous Articles, Stock Material |
| CURRENT CPC | Stock material or miscellaneous articles 428/321.500 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703500 | Zang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ling Zang (Salt Lake City, Utah); Yanke Che (Salt Lake City, Utah) |
| ASSIGNEE(S) | University of Utah Research Foundation (Salt Lake City, Utah) |
| INVENTOR(S) | Ling Zang (Salt Lake City, Utah); Yanke Che (Salt Lake City, Utah) |
| ABSTRACT | A chemical sensor can include a nanofiber mass of p-type nanofibers having a HOMO level greater than −5.0 eV. Additionally, the chemical sensor can include oxygen in contact with the p-type nanofibers. Further, the chemical sensor can include a pair of electrodes in electrical contact across the nanofiber mass, where the p-type nanofibers conduct an electric current that decreases upon contact with an amine compound. |
| FILED | Wednesday, March 23, 2011 |
| APPL NO | 13/636642 |
| ART UNIT | 1777 — Chemical Apparatus, Separation and Purification, Liquid and Gas Contact Apparatus |
| CURRENT CPC | Nanostructures Formed by Manipulation of Individual Atoms, Molecules, or Limited Collections of Atoms or Molecules as Discrete Units; Manufacture or Treatment Thereof B82B 1/00 (20130101) B82B 1/008 (20130101) Specific Uses or Applications of Nanostructures; Measurement or Analysis of Nanostructures; Manufacture or Treatment of Nanostructures B82Y 15/00 (20130101) Investigating or Analysing Materials by Determining Their Chemical or Physical Properties G01N 27/26 (20130101) G01N 27/4141 (20130101) G01N 27/4146 (20130101) Original (OR) Class G01N 33/0036 (20130101) |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703501 | Mead et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Joey L. Mead (Carlisle, Massachusetts); Carol M. F. Barry (Tyngsboro, Massachusetts); Ahmed Busnaina (Ashland, Massachusetts); Ming Wei (Lowell, Massachusetts); Zhenghong Tao (Spring Lake, New Jersey) |
| ASSIGNEE(S) | Northeastern University (Boston, Massachusetts) |
| INVENTOR(S) | Joey L. Mead (Carlisle, Massachusetts); Carol M. F. Barry (Tyngsboro, Massachusetts); Ahmed Busnaina (Ashland, Massachusetts); Ming Wei (Lowell, Massachusetts); Zhenghong Tao (Spring Lake, New Jersey) |
| ABSTRACT | The present invention provides a method for directed assembly of a conducting polymer. A method of the invention comprises providing a template such as an insulated template and electrophorectically assembling a conducting polymer thereon. Preferably, the template comprises a patterned electrode on which the conducting polymer is assembled. Moreover, the invention provides a method for transferring an assembled conducting polymer. For example, a method of the invention comprises providing a substrate such as a polymeric substrate and contacting a surface thereof with an assembled conducting polymer. The assembled conducting polymer can be disposed on a patterned electrode of a template, hi one embodiment, a method comprises removing the substrate. By removing the substrate, the assembled conducting polymer is transferred from the patterned electrode of the template to the substrate. The invention also provides a device with a template or substrate comprising an assembled conducting polymer. |
| FILED | Wednesday, June 07, 2006 |
| APPL NO | 11/921715 |
| ART UNIT | 1777 — Chemical Apparatus, Separation and Purification, Liquid and Gas Contact Apparatus |
| CURRENT CPC | Chemistry: Analytical and immunological testing 436/149 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703665 | Branson et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Blake T. Branson (Irving, Texas); Charles M. Lukehart (Nashville, Tennessee); Jim L. Davidson (Brentwood, Tennessee) |
| ASSIGNEE(S) | Vanderbilt University (Nashville, Tennessee) |
| INVENTOR(S) | Blake T. Branson (Irving, Texas); Charles M. Lukehart (Nashville, Tennessee); Jim L. Davidson (Brentwood, Tennessee) |
| ABSTRACT | Heat-transfer fluids and lubricating fluids comprising deaggregated diamond nanoparticles are described herein. Also described are composites comprising deaggregated diamond nanoparticles, and methods of making such composites. Method of using deaggregated diamond nanoparticles, for example, to improve the properties of materials such as thermal conductivity and lubricity are also disclosed. |
| FILED | Wednesday, January 12, 2011 |
| APPL NO | 13/005295 |
| ART UNIT | 1771 — Chemical Apparatus, Separation and Purification, Liquid and Gas Contact Apparatus |
| CURRENT CPC | Solid anti-friction devices, materials therefor, lubricant or separant compositions for moving solid surfaces, and miscellaneous mineral oil compositions 58/113 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703829 | Hammond et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Gerald B. Hammond (Louisville, Kentucky); Bo Xu (Louisville, Kentucky); Paula J. Bates (Louisville, Kentucky) |
| ASSIGNEE(S) | University of Louisville Research Foundation, Inc. (Louisville, Kentucky) |
| INVENTOR(S) | Gerald B. Hammond (Louisville, Kentucky); Bo Xu (Louisville, Kentucky); Paula J. Bates (Louisville, Kentucky) |
| ABSTRACT | The invention provides compounds of Formula (I): R1≡R2 (I) wherein R1 and R2 have any of the values or specific values defined herein, as well as compositions comprising such compounds and therapeutic methods comprising the administration of such compounds. |
| FILED | Wednesday, May 23, 2012 |
| APPL NO | 13/478789 |
| ART UNIT | 1621 — Organic Chemistry |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/745 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703838 | Webster et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Dean C. Webster (Fargo, North Dakota); Neena Ravindran (Fargo, North Dakota); Ankit Vora (San Jose, California) |
| ASSIGNEE(S) | NDSU Research Foundation (Fargo, North Dakota) |
| INVENTOR(S) | Dean C. Webster (Fargo, North Dakota); Neena Ravindran (Fargo, North Dakota); Ankit Vora (San Jose, California) |
| ABSTRACT | The invention provides an improved unsaturated polyester prepared from the polycondensation of unsaturated diacid monomers or unsaturated acid anhydride mononers and polyol monomers and, optionally, one or more saturated aliphatic or aromatic diacid monomers or anhydride monomers thereof. The improvement comprises 0.5 to 50 weight percent, based on the total monomer weight, of a hydroxyalkyl-functional siloxane of formula (1) below. The invention also relates to a UV curable coating formulation containing a siloxane-functional unsaturated polyester resin, a vinyl ether functional diluents and a photoinitiator. The invention further provides a method of preparing an article with a low-surface energy coating. According to the method, at least one surface of an article with a coating formulation of the invention; and the coating is then cured as described above with UV light to form a low-surface energy coating on the surface. The invention also relates to articles having a low-surface energy coating according to the invention. |
| FILED | Friday, February 20, 2009 |
| APPL NO | 12/867901 |
| ART UNIT | 1767 — Organic Chemistry, Polymers, Compositions |
| CURRENT CPC | Synthetic resins or natural rubbers 522/148 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703895 | Edmiston |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Paul L. Edmiston (Wooster, Ohio) |
| ASSIGNEE(S) | |
| INVENTOR(S) | Paul L. Edmiston (Wooster, Ohio) |
| ABSTRACT | Disclosed is a method and system for controlling the flow of an organic liquid by flowing an organic liquid through a pipe having an upstream end with an unconstricted portion and a downstream end with a constricted portion, the constricted portion having an inner diameter that is at least 10% smaller than the inner diameter of the unconstricted portion, and a porous plug formed of sol-gel derived particles in the pipe, the plug having a length at least two times the diameter of the pipe. Also disclosed is a method and system, the system including a housing having a liquid inlet and a liquid outlet and containing a sol-gel derived composition and a liquid pressure sensitive control means operatively connected to the liquid inlet for controlling the flow of the organic liquid, contacting the sol-gel derived composition to actuate the liquid pressure sensitive control means and controlling the flow of the organic liquid in response to the actuation. |
| FILED | Thursday, June 09, 2011 |
| APPL NO | 13/157274 |
| ART UNIT | 1765 — Organic Chemistry, Polymers, Compositions |
| CURRENT CPC | Synthetic resins or natural rubbers 528/35 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703909 | Reshetnyak et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Yana K. Reshetnyak (South Kingstown, Rhode Island); Oleg A. Andreev (South Kingstown, Rhode Island); Ursula Lehnert (Richmond, United Kingdom); Donald M. Engelman (New Haven, Connecticut) |
| ASSIGNEE(S) | Yale University (New Haven, Connecticut) |
| INVENTOR(S) | Yana K. Reshetnyak (South Kingstown, Rhode Island); Oleg A. Andreev (South Kingstown, Rhode Island); Ursula Lehnert (Richmond, United Kingdom); Donald M. Engelman (New Haven, Connecticut) |
| ABSTRACT | A polypeptide with a predominantly hydrophobic sequence long enough to span a membrane lipid bilayer as a transmembrane helix (TM) and comprising one or more dissociable groups inserts across a membrane spontaneously in a pH-dependant fashion placing one terminus inside cell. The polypeptide conjugated with various functional moieties delivers and accumulates them at cell membrane with low extracellular pH. The functional moiety conjugated with polypeptide terminus placed inside cell are translocated through the cell membrane in cytosol. The peptide and its variants or non-peptide analogs can be used to deliver therapeutic, prophylactic, diagnostic, imaging, gene regulation, cell regulation, or immunologic agents to or inside of cells in vitro or in vivo in tissue at low extracellular pH. |
| FILED | Monday, December 12, 2011 |
| APPL NO | 13/316742 |
| ART UNIT | 1658 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Chemistry: Natural resins or derivatives; peptides or proteins; lignins or reaction products thereof 530/324 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703970 | Steinmetz et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Marquette University (Milwaukee, Wisconsin) |
| ASSIGNEE(S) | Marquette University (Milwaukee, Wisconsin) |
| INVENTOR(S) | Mark G. Steinmetz (Whitefish Bay, Wisconsin); Majher I. Sarker (Milwaukee, Wisconsin); Tasnuva Shahrin (Milwaukee, Wisconsin) |
| ABSTRACT | Disclosed herein are compounds having photoremovable protecting groups which are removed after the compounds absorbs light of a given wavelength and undergo an electrocyclic reaction between a chromophore in the compound attached via an anilide to a benzothiophene ring. |
| FILED | Wednesday, February 27, 2013 |
| APPL NO | 13/779141 |
| ART UNIT | 1625 — Organic Chemistry |
| CURRENT CPC | Organic compounds 549/57 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704044 | Gallie et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Daniel R. Gallie (Riverside, California); Todd E. Young (Palm Springs, California) |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Daniel R. Gallie (Riverside, California); Todd E. Young (Palm Springs, California) |
| ABSTRACT | The present invention is directed to plant genetic engineering. In particular, it is directed to producing green leaves in maize through inhibition of ethylene. The genes involved in producing this phenotype include 1-Aminocyclopropane-1-Carboxylate (“ACC”) synthase, ACC oxidase, ACC deaminase, ethylene response sensor (“ERS”), ethylene resistant (“ETR”), and ethylene insensitive (“EIN”). |
| FILED | Monday, March 19, 2007 |
| APPL NO | 11/688162 |
| ART UNIT | 1638 — Organic Chemistry |
| CURRENT CPC | Multicellular living organisms and unmodified parts thereof and related processes 8/298 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704155 | He et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Lina He (St. Louis, Missouri); Jiangang Zhu (St. Louis, Missouri); Sahin Kaya Ozdemir (St. Louis, Missouri); Lan Yang (St. Louis, Missouri); Da-Ren Chen (St. Louis, Missouri) |
| ASSIGNEE(S) | Washington University (St. Louis, Missouri) |
| INVENTOR(S) | Lina He (St. Louis, Missouri); Jiangang Zhu (St. Louis, Missouri); Sahin Kaya Ozdemir (St. Louis, Missouri); Lan Yang (St. Louis, Missouri); Da-Ren Chen (St. Louis, Missouri) |
| ABSTRACT | Detection of individual objects using a light source and a whispering gallery mode (WGM) resonator. Light from the whispering gallery mode (WGM) resonator is analyzed. The presence of an object is determined based on mode splitting associated with the light received by the photodetector. For example, the presence of the object may be determined based on the distance between two whispering gallery modes and/or the linewidths of the two modes in a transmission spectrum. Alternatively, the presence of the object may be determined based on a beat frequency that is determined based on a heterodyne beat signal produced by combining split laser modes in the received light from a WGM microcavity laser. |
| FILED | Monday, December 13, 2010 |
| APPL NO | 12/966785 |
| ART UNIT | 2878 — Optics |
| CURRENT CPC | Radiant energy 250/227.180 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705032 | Herzinger et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Craig M. Herzinger (Lincoln, Nebraska); Mathias M. Schubert (Lincoln, Nebraska); Tino Hofmann (Lincoln, Nebraska); Martin M. Liphardt (Lincoln, Nebraska); John A. Woollam (Lincoln, Nebraska) |
| ASSIGNEE(S) | J.A. Woollam Co., Inc (Lincoln, Nebraska) |
| INVENTOR(S) | Craig M. Herzinger (Lincoln, Nebraska); Mathias M. Schubert (Lincoln, Nebraska); Tino Hofmann (Lincoln, Nebraska); Martin M. Liphardt (Lincoln, Nebraska); John A. Woollam (Lincoln, Nebraska) |
| ABSTRACT | The present invention relates to ellipsometer and polarimeter systems, and more particularly is an ellipsometer or polarimeter or the like system which operates in a frequency range between 300 GHz or lower and extending to higher than at least 1 Tera-hertz (THz), and preferably through the Infra-red (IR) range up to, and higher than 100 THz, including: a source such as a backward wave oscillator; a Smith-Purcell cell; a free electron laser, or an FTIR source and a solid state device; and a detector such as a Golay cell; a bolometer or a solid state detector; and preferably including a polarization state generator comprising: an odd bounce image rotating system and a polarizer, or two polarizers; and optionally including least one compensator and/or modulator, in addition to an analyzer. |
| FILED | Thursday, March 07, 2013 |
| APPL NO | 13/815487 |
| ART UNIT | 2886 — Optics |
| CURRENT CPC | Optics: Measuring and testing 356/364 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705345 | Kamal et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ahmed E. Kamal (Ames, Iowa); Salah A. Aly (Ames, Iowa) |
| ASSIGNEE(S) | Iowa State University Research Foundation, Inc. (Ames, Iowa) |
| INVENTOR(S) | Ahmed E. Kamal (Ames, Iowa); Salah A. Aly (Ames, Iowa) |
| ABSTRACT | A method for protecting against link failures in a communications network having a plurality of paths between senders and receivers is provided. The method includes sending data units by the senders over the communications network on working circuits, applying network coding to form a combination of data units from data units from a plurality of the senders, and sending the combination of data units over the communications network on a backup circuit. If one or more link failures occur in the working circuits resulting in loss of one or more of the data units, then the method further includes recovering the one or more of the data units from the combination of data units transmitted on the backup circuit. The backup circuit used to carry the combination of data units may be implemented in-band with user data or may be implemented as out-of-band backup circuits. |
| FILED | Friday, August 15, 2008 |
| APPL NO | 12/192765 |
| ART UNIT | 2473 — Multiplex and VoIP |
| CURRENT CPC | Multiplex communications 370/217 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705898 | Wong et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Chee Wei Wong (New York, New York); Xiaodong Yang (New York, New York); Charlton Chen (Gambrills, Maryland); Chad Husko (New York, New York) |
| ASSIGNEE(S) | The Trustees of Columbia University in the City of New York (New York, New York) |
| INVENTOR(S) | Chee Wei Wong (New York, New York); Xiaodong Yang (New York, New York); Charlton Chen (Gambrills, Maryland); Chad Husko (New York, New York) |
| ABSTRACT | Some embodiments of the disclosed subject matter provide systems, devices, and methods for tuning resonant wavelengths of an optical resonator. Some embodiments of the disclosed subject matter provide systems, devices, and methods for tuning dispersion properties of photonic crystal waveguides. In some embodiments, methods for tuning a resonant wavelength of an optical resonator are provided, the methods including: providing an optical resonator having a surface; determining an initial resonant wavelength emitted by the optical resonator in response to an electromagnetic radiation input; determining a number of layers of dielectric material based on a difference between the initial resonant wavelength and a target resonant wavelength and a predetermined tuning characteristic; and applying the determined number of layers of dielectric material to the surface of the optical resonator to tune the initial resonant wavelength to a tuned resonant wavelength. |
| FILED | Monday, June 16, 2008 |
| APPL NO | 12/664627 |
| ART UNIT | 2883 — Optics |
| CURRENT CPC | Optical waveguides 385/1 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706186 | Fichtinger et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Gabor Fichtinger (Bethesda, Maryland); Ergin Atalar (Bilkent Ankara, Turkey); Louis L. Whitcomb (Baltimore, Maryland); Robert Charles Susil (Baltimore, Maryland); Axel Krieger (San Antonio, Texas); Attila Tanacs (Zakanyszek, Hungary) |
| ASSIGNEE(S) | The Johns Hopkins University (Baltimore, Maryland) |
| INVENTOR(S) | Gabor Fichtinger (Bethesda, Maryland); Ergin Atalar (Bilkent Ankara, Turkey); Louis L. Whitcomb (Baltimore, Maryland); Robert Charles Susil (Baltimore, Maryland); Axel Krieger (San Antonio, Texas); Attila Tanacs (Zakanyszek, Hungary) |
| ABSTRACT | The end-effector (150) includes a sheath (152) and a medical device or needle carrier (154) that is disposed within the interior compartment (160) of the sheath. Aperture (162) is located in a portion of the sheath proximal a distal end of the sheath that is inserted into a natural or artificial cavity. This device is guided by a real-time imager. |
| FILED | Wednesday, July 11, 2012 |
| APPL NO | 13/546782 |
| ART UNIT | 3737 — Telecommunications: Analog Radio Telephone; Satellite and Power Control; Transceivers, Measuring and Testing; Bluetooth; Receivers and Transmitters; Equipment Details |
| CURRENT CPC | Surgery 6/407 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706276 | Ellis et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Daniel P. W. Ellis (New York, New York); Courtenay V. Cotton (New York, New York) |
| ASSIGNEE(S) | The Trustees of Columbia University in the City of New York (New York, New York) |
| INVENTOR(S) | Daniel P. W. Ellis (New York, New York); Courtenay V. Cotton (New York, New York) |
| ABSTRACT | System, methods, and media that: receive a first piece of audio content; identify a first plurality of atoms that describe at least a portion of the first piece of audio content using a Matching Pursuit algorithm; form a first group of atoms from at least a portion of the first plurality of atoms, the first group of atoms having first group parameters; form at least one first hash value for the first group of atoms based on the first group parameters; compare the at least one first hash value with at least one second hash value, wherein the at least one second hash value is based on second group parameters of a second group of atoms associated with a second piece of audio content; and identify a match between the first piece of audio content and the second piece of audio content based on the comparing. |
| FILED | Tuesday, October 12, 2010 |
| APPL NO | 12/902859 |
| ART UNIT | 2656 — Digital Audio Data Processing |
| CURRENT CPC | Data processing: Generic control systems or specific applications 7/94 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706414 | Funk et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Benjamin E. Funk (Silver Spring, Maryland); Amrit Bandyopadhyay (Greenbelt, Maryland); Eric A. Kohn (Washington, District of Columbia); Neil Goldsman (Takoma Park, Maryland); Carole A. Teolis (Glendale, Maryland); Gilmer L. Blankeship (Washington, District of Columbia) |
| ASSIGNEE(S) | TRX Systems, Inc. (Greenbelt, Maryland) |
| INVENTOR(S) | Benjamin E. Funk (Silver Spring, Maryland); Amrit Bandyopadhyay (Greenbelt, Maryland); Eric A. Kohn (Washington, District of Columbia); Neil Goldsman (Takoma Park, Maryland); Carole A. Teolis (Glendale, Maryland); Gilmer L. Blankeship (Washington, District of Columbia) |
| ABSTRACT | The invention is directed to methods and systems for locating and monitoring the status of people and moveable assets, such as first responders, including firefighters and other public service personnel, and their equipment both indoors and out. The invention provides for locating and monitoring the status of people and assets in environments where GPS systems do not operate, or where operation is impaired or otherwise limited. The system and method uses inertial navigation to determine the location, motion and orientation of the personnel or assets and communicates with an external monitoring station to receive requests for location, motion orientation and status information and to transmit the location, motion orientation and status information to the monitoring station. |
| FILED | Friday, September 14, 2012 |
| APPL NO | 13/616323 |
| ART UNIT | 3667 — Computerized Vehicle Controls and Navigation, Radio Wave, Optical and Acoustic Wave Communication, Robotics, and Nuclear Systems |
| CURRENT CPC | Data processing: Vehicles, navigation, and relative location 71/495 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706427 | Haque et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Imran Haque (Woodside, California); Vijay Pande (Los Altos, California) |
| ASSIGNEE(S) | The Board of Trustees of the Leland Stanford Junior University (Palo Alto, California) |
| INVENTOR(S) | Imran Haque (Woodside, California); Vijay Pande (Los Altos, California) |
| ABSTRACT | Methods and algorithms are presented that implement linear algebraic techniques for rapidly estimating chemical similarities for several popular measures. The methods of the present invention reflect source similarity measures for both Tanimoto calculation and rank ordering. After a precalculation step on a database, the methods of the present invention afford several orders of magnitude of speedup in database screening. The present invention also provides an asymptotic speedup for large similarity matrix construction problems, reducing the number of conventional slow similarity evaluations required from quadratic to linear scaling. |
| FILED | Saturday, February 26, 2011 |
| APPL NO | 13/035961 |
| ART UNIT | 2865 — Printing/Measuring and Testing |
| CURRENT CPC | Data processing: Measuring, calibrating, or testing 72/32 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706647 | Pathak et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Nishith Pathak (Minneapolis, Minnesota); Senthilkumar Krishnamoorthy (Minneapolis, Minnesota); Jaideep Srivastava (Plymouth, Minnesota); Dmitri Williams (Redondo Beach, California) |
| ASSIGNEE(S) | University of Southern California (Los Angeles, California); Regents of the University of Minnesota (Minneapolis, Minnesota) |
| INVENTOR(S) | Nishith Pathak (Minneapolis, Minnesota); Senthilkumar Krishnamoorthy (Minneapolis, Minnesota); Jaideep Srivastava (Plymouth, Minnesota); Dmitri Williams (Redondo Beach, California) |
| ABSTRACT | The social influence that each person in a computer network system exercises over others in the system may be valued by aggregating the differences in value of each of the others to the network both with and without the person being present. This calculated influence may be used as a basis for charging advertisers for advertisements to the users, as well as for providing preferential treatment to users that exert the greatest influence. |
| FILED | Friday, September 23, 2011 |
| APPL NO | 13/243624 |
| ART UNIT | 3629 — Business Methods - Incentive Programs, Coupons; Operations Research; Electronic Shopping; Health Care; Point of Sale, Inventory, Accounting; Cost/ Price, Reservations, Shipping and Transportation; Business Processing |
| CURRENT CPC | Data processing: Financial, business practice, management, or cost/price determination 75/319 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706652 | Yang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Lei Yang (Sunnydale, California); Robert P. Dick (Chelsea, Michigan); Xi Chen (San Jose, California); Gokhan Memik (Evanston, Illinois); Peter A. Dinda (Evanston, Illinois); Alex Shye (Evanston, Illinois); Berkin Ozisikyilmaz (Chicago, Illinois); Arindam Mallik (Leuven, Belgium); Alok Choudhary (Chicago, Illinois) |
| ASSIGNEE(S) | Northwestern University (Evanston, Illinois) |
| INVENTOR(S) | Lei Yang (Sunnydale, California); Robert P. Dick (Chelsea, Michigan); Xi Chen (San Jose, California); Gokhan Memik (Evanston, Illinois); Peter A. Dinda (Evanston, Illinois); Alex Shye (Evanston, Illinois); Berkin Ozisikyilmaz (Chicago, Illinois); Arindam Mallik (Leuven, Belgium); Alok Choudhary (Chicago, Illinois) |
| ABSTRACT | Systems and methods for controlling power consumption in a computer system. For each of a plurality of interactive applications, the method changes a frequency at which a processor of the computer system runs, receives an indication of user satisfaction, determines a relationship between the changed frequency and the user satisfaction of the interactive application, and stores the determined relationship information. The determined relationship can distinguish between different users and different interactive applications. A frequency may be selected from the discrete frequencies at which the processor of the computer system runs based on the determined relationship information for a particular user and a particular interactive application running on the processor of the computer system. The processor may be adapted to run at the selected frequency. |
| FILED | Wednesday, June 09, 2010 |
| APPL NO | 12/796934 |
| ART UNIT | 2122 — AI & Simulation/Modeling |
| CURRENT CPC | Data processing: Artificial intelligence 76/12 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706729 | Welinder et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | California Institute of Technology (Pasadena, California) |
| ASSIGNEE(S) | California Institute of Technology (Pasadena, California) |
| INVENTOR(S) | Peter Welinder (San Diego, California); Pietro Perona (Altadena, California) |
| ABSTRACT | Systems and methods for distributed data annotation in accordance embodiments of the invention are disclosed. In one embodiment of the invention, a distributed data annotation server system includes a storage device configured to store source data, one or more annotators, annotation tasks and a processor, wherein a distributed data annotation application configures the processor to receive source data including one or more pieces of source data, select one or more annotators, create one or more annotation tasks for the selected annotators and source data, request one or more annotations for the source data using the annotation tasks, receive annotations, determine source data metadata for at least one piece of source data using the received annotations, generate annotator metadata for at least one annotator using the received annotations and the source data, and estimate the ground truth for the source data using the source data metadata and the annotator metadata. |
| FILED | Friday, October 12, 2012 |
| APPL NO | 13/651108 |
| ART UNIT | 2162 — Data Bases & File Management |
| CURRENT CPC | Data processing: Database and file management or data structures 77/736 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US RE44856 | Adelson |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Edward Adelson (Winchester, Massachusetts) |
| ASSIGNEE(S) | Massachusetts Institute of Technology (Cambridge, Massachusetts) |
| INVENTOR(S) | Edward Adelson (Winchester, Massachusetts) |
| ABSTRACT | A tactile sensor includes a photosensing structure, a volume of elastomer capable of transmitting an image, and a reflective skin covering the volume of elastomer. The reflective skin is illuminated through the volume of elastomer by one or more light sources, and has particles that reflect light incident on the reflective skin from within the volume of elastomer. The reflective skin is geometrically altered in response to pressure applied by an entity touching the reflective skin, the geometrical alteration causing localized changes in the surface normal of the skin and associated localized changes in the amount of light reflected from the reflective skin in the direction of the photosensing structure. The photosensing structure receives a portion of the reflected light in the form of an image, the image indicating one or more features of the entity producing the pressure. |
| FILED | Tuesday, August 20, 2013 |
| APPL NO | 13/971456 |
| ART UNIT | 2482 — Recording and Compression |
| CURRENT CPC | Diagnosis; Surgery; Identification A61B 5/1172 (20130101) Original (OR) Class |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Energy (DOE)
| US 08701415 | Flanagan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | James Scott Flanagan (Simpsonville, South Carolina); Jeffrey Scott LeBegue (Simpsonville, South Carolina); Kevin Weston McMahan (Greer, South Carolina); Daniel Jackson Dillard (Greenville, South Carolina); Ronnie Ray Pentecost (Travelers Rest, South Carolina) |
| ASSIGNEE(S) | General Electric Company (Schenectady, New York) |
| INVENTOR(S) | James Scott Flanagan (Simpsonville, South Carolina); Jeffrey Scott LeBegue (Simpsonville, South Carolina); Kevin Weston McMahan (Greer, South Carolina); Daniel Jackson Dillard (Greenville, South Carolina); Ronnie Ray Pentecost (Travelers Rest, South Carolina) |
| ABSTRACT | A turbine system is disclosed. In one embodiment, the turbine system includes a transition duct. The transition duct includes an inlet, an outlet, and a passage extending between the inlet and the outlet and defining a longitudinal axis, a radial axis, and a tangential axis. The outlet of the transition duct is offset from the inlet along the longitudinal axis and the tangential axis. The transition duct further includes an interface member for interfacing with a turbine section. The turbine system further includes a flexible metallic seal contacting the interface member to provide a seal between the interface member and the turbine section. |
| FILED | Wednesday, November 09, 2011 |
| APPL NO | 13/292389 |
| ART UNIT | 3741 — Thermal & Combustion Technology, Motive & Fluid Power Systems |
| CURRENT CPC | Power plants 060/752 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701419 | Hughes |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Michael John Hughes (Greer, South Carolina) |
| ASSIGNEE(S) | General Electric Company (Schenectady, New York) |
| INVENTOR(S) | Michael John Hughes (Greer, South Carolina) |
| ABSTRACT | A system includes a multi-tube fuel nozzle having an inlet plate and a plurality of tubes adjacent the inlet plate. The inlet plate includes a plurality of apertures, and each aperture includes an inlet feature. Each tube of the plurality of tubes is coupled to an aperture of the plurality of apertures. The multi-tube fuel nozzle includes a differential configuration of inlet features among the plurality of tubes. |
| FILED | Thursday, May 10, 2012 |
| APPL NO | 13/468961 |
| ART UNIT | 3741 — Thermal & Combustion Technology, Motive & Fluid Power Systems |
| CURRENT CPC | Power plants 060/772 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701453 | Golovashchenko |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Sergey Fedorovich Golovashchenko (Beverly Hills, Michigan) |
| ASSIGNEE(S) | Ford Global Technologies, LLC (Dearborn, Michigan) |
| INVENTOR(S) | Sergey Fedorovich Golovashchenko (Beverly Hills, Michigan) |
| ABSTRACT | A hydro-forming tool for use in a method of forming a blank into a liquid filled chamber. The chamber is formed by a container ring and a moveable wall that together define a variable volume chamber for containing the liquid. The wall is moveable relative to the container ring to provide a chamber in which the volume of liquid required to back up the blank is minimized. The liquid reduces friction at the chamber entry rim. Liquid may be ported through a counter punch to hydro-form the blank into the detail forming areas. |
| FILED | Thursday, December 23, 2010 |
| APPL NO | 12/977650 |
| ART UNIT | 3725 — Manufacturing Devices & Processes, Machine Tools & Hand Tools Group Art Units |
| CURRENT CPC | Metal deforming 072/57 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701560 | Condit et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Reston A. Condit (Idaho Falls, Idaho); Michael A. Daniels (Idaho Falls, Idaho); Gregory P. Clemens (Idaho Falls, Idaho); Eric S. Tomberlin (Idaho Falls, Idaho); Joel A. Johnson (Rigby, Idaho) |
| ASSIGNEE(S) | Battelle Energy Alliance, LLC (Idaho Falls, Idaho) |
| INVENTOR(S) | Reston A. Condit (Idaho Falls, Idaho); Michael A. Daniels (Idaho Falls, Idaho); Gregory P. Clemens (Idaho Falls, Idaho); Eric S. Tomberlin (Idaho Falls, Idaho); Joel A. Johnson (Rigby, Idaho) |
| ABSTRACT | A timer key relating to monitoring a countdown time of a countdown routine of an electronic device is disclosed. The timer key comprises a processor configured to respond to a countdown time associated with operation of the electronic device, a display operably coupled with the processor, and a housing configured to house at least the processor. The housing has an associated structure configured to engage with the electronic device to share the countdown time between the electronic device and the timer key. The processor is configured to begin a countdown routine based at least in part on the countdown time, wherein the countdown routine is at least substantially synchronized with a countdown routine of the electronic device when the timer key is removed from the electronic device. A system and method for synchronizing countdown routines of a timer key and an electronic device are also disclosed. |
| FILED | Monday, November 22, 2010 |
| APPL NO | 12/952025 |
| ART UNIT | 3641 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Ammunition and explosives 12/276 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701572 | Donais et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Richard E. Donais (West Suffield, Connecticut); Todd D. Hellewell (Windsor, Connecticut); Robert D. Lewis (Cromwell, Connecticut); Galen H. Richards (Tremonton, Utah); David P. Towle (Simsbury, Connecticut) |
| ASSIGNEE(S) | ALSTOM Technology Ltd (Baden, Switzerland) |
| INVENTOR(S) | Richard E. Donais (West Suffield, Connecticut); Todd D. Hellewell (Windsor, Connecticut); Robert D. Lewis (Cromwell, Connecticut); Galen H. Richards (Tremonton, Utah); David P. Towle (Simsbury, Connecticut) |
| ABSTRACT | A nozzle tip [100] for a pulverized solid fuel pipe nozzle [200] of a pulverized solid fuel-fired furnace includes: a primary air shroud [120] having an inlet [102] and an outlet [104], wherein the inlet [102] receives a fuel flow [230]; and a flow splitter [180] disposed within the primary air shroud [120], wherein the flow splitter disperses particles in the fuel flow [230] to the outlet [104] to provide a fuel flow jet which reduces NOx in the pulverized solid fuel-fired furnace. In alternative embodiments, the flow splitter [180] may be wedge shaped and extend partially or entirely across the outlet [104]. In another alternative embodiment, flow splitter [180] may be moved forward toward the inlet [102] to create a recessed design. |
| FILED | Thursday, February 26, 2009 |
| APPL NO | 12/393439 |
| ART UNIT | 3743 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Furnaces 110/104.B00 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701794 | Zediker et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Foro Energy Inc. (Littleton, Colorado) |
| ASSIGNEE(S) | Foro Energy, Inc. (Littleton, Colorado) |
| INVENTOR(S) | Mark S. Zediker (Castle Rock, Colorado); Charles C. Rinzler (Denver, Colorado); Brian O. Faircloth (Evergreen, Colorado); Yeshaya Koblick (Sharon, Massachusetts); Joel F. Moxley (Denver, Colorado) |
| ABSTRACT | Systems devices and methods for the transmission of 1 kW or more of laser energy deep into the earth and for the suppression of associated nonlinear phenomena. Systems, devices and methods for the laser perforation of a borehole in the earth. These systems can deliver high power laser energy down a deep borehole, while maintaining the high power to perforate such boreholes. |
| FILED | Wednesday, March 13, 2013 |
| APPL NO | 13/800559 |
| ART UNIT | 3676 — Wells, Earth Boring/Moving/Working, Excavating, Mining, Harvesters, Bridges, Roads, Petroleum, Closures, Connections, and Hardware |
| CURRENT CPC | Boring or penetrating the earth 175/16 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08701970 | Ripley |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Edward B. Ripley (Knoxville, Tennessee) |
| ASSIGNEE(S) | Babcock and Wilcox Technical Services Y-12, LLC (Oak Ridge, Tennessee) |
| INVENTOR(S) | Edward B. Ripley (Knoxville, Tennessee) |
| ABSTRACT | A method of forming and assembling at least two parts together that may be metal, ceramic, or a combination of metal and ceramic parts. Such parts may have different CTE. Individual parts that are formed and sintered from particles leave a network of interconnecting porosity in each sintered part. The separate parts are assembled together and then a fill material is infiltrated into the assembled parts using a method such as capillary action, gravity, and/or pressure. The assembly is then cured to yield a bonded and fully or near-fully dense part that has the desired physical and mechanical properties for the part's intended purpose. Structural strength may be added to the parts by the inclusion of fibrous materials. |
| FILED | Friday, June 17, 2011 |
| APPL NO | 13/162614 |
| ART UNIT | 1733 — Metallurgy, Metal Working, Inorganic Chemistry, Catalyst, Electrophotography, Photolithography |
| CURRENT CPC | Metal fusion bonding 228/122.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08702080 | Halpin |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | John Michael Halpin (Tracy, California) |
| ASSIGNEE(S) | Lawrence Livermore National Security, LLC (Livermore, California) |
| INVENTOR(S) | John Michael Halpin (Tracy, California) |
| ABSTRACT | A dual resolution translation stage includes a stage assembly operable to receive an optical element and a low resolution adjustment device mechanically coupled to the stage assembly. The dual resolution stage also includes an adjustable pivot block mechanically coupled to the stage assembly. The adjustable pivot block includes a pivot shaft. The dual resolution stage further includes a lever arm mechanically coupled to the adjustable pivot block. The lever arm is operable to pivot about the pivot shaft. The dual resolution stage additionally includes a high resolution adjustment device mechanically coupled to the lever arm and the stage assembly. |
| FILED | Tuesday, May 18, 2010 |
| APPL NO | 12/782640 |
| ART UNIT | 3635 — Static Structures, Supports and Furniture |
| CURRENT CPC | Work holders 269/60 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08702946 | Chirica et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Gabriela S. Chirica (Livermore, California); Gregory J. Fiechtner (Germantown, Maryland); Anup K. Singh (Danville, California) |
| ASSIGNEE(S) | Sandia Corporation (Albuquerque, New Mexico) |
| INVENTOR(S) | Gabriela S. Chirica (Livermore, California); Gregory J. Fiechtner (Germantown, Maryland); Anup K. Singh (Danville, California) |
| ABSTRACT | Disclosed herein are methods and devices for dielectrokinetic chromatography. As disclosed, the devices comprise microchannels having at least one perturber which produces a non-uniformity in a field spanning the width of the microchannel. The interaction of the field non-uniformity with a perturber produces a secondary flow which competes with a primary flow. By decreasing the size of the perturber the secondary flow becomes significant for particles/analytes in the nanometer-size range. Depending on the nature of a particle/analyte present in the fluid and its interaction with the primary flow and the secondary flow, the analyte may be retained or redirected. The composition of the primary flow can be varied to affect the magnitude of primary and/or secondary flows on the particles/analytes and thereby separate and concentrate it from other particles/analytes. |
| FILED | Thursday, May 29, 2008 |
| APPL NO | 12/128913 |
| ART UNIT | 1759 — Tires, Adhesive Bonding, Glass/Paper making, Plastics Shaping & Molding |
| CURRENT CPC | Chemistry: Electrical and wave energy 24/547 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703009 | Liu et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Gao Liu (Oakland, California); Vincent S. Battaglia (San Anselmo, California); Honghe Zheng (Albany, California) |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Gao Liu (Oakland, California); Vincent S. Battaglia (San Anselmo, California); Honghe Zheng (Albany, California) |
| ABSTRACT | The present invention provides for a lithium ion battery and process for creating such, comprising higher binder to carbon conductor ratios than presently used in the industry. The battery is characterized by much lower interfacial resistances at the anode and cathode as a result of initially mixing a carbon conductor with a binder, then with the active material. Further improvements in cycleability can also be realized by first mixing the carbon conductor with the active material first and then adding the binder. |
| FILED | Friday, November 06, 2009 |
| APPL NO | 12/614195 |
| ART UNIT | 1766 — Organic Chemistry, Polymers, Compositions |
| CURRENT CPC | Compositions 252/182.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703021 | Kwong et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Kyei-Sing Kwong (Albany, Oregon); James P. Bennett (Salem, Oregon); Jinichiro Nakano (Albany, Oregon) |
| ASSIGNEE(S) | U.S. Department of Energy (Washington, District of Columbia) |
| INVENTOR(S) | Kyei-Sing Kwong (Albany, Oregon); James P. Bennett (Salem, Oregon); Jinichiro Nakano (Albany, Oregon) |
| ABSTRACT | The disclosure provides methods of operating a slagging gasifier using a carbon feedstock having a relatively high V2O5 to SiO2 ratio, such as petcoke. The disclosure generates a combined chemical composition in the feed mixture having less than 25 wt. % SiO2, greater than 20 wt. % V2O5, and greater than 20 wt. % CaO. The method takes advantage of a novel recognition that increased levels of SiO2 tend to decrease dissolution of the V2O3 which forms under the reducing conditions of the gasifier, and utilizes the CaO additive to establish a chemical phase equilibria comprised of lower melting compounds. The method further provides for control based on the presence of Al2O3 and FeO, and provides for a total combined chemical composition of greater than about 5 wt. % MgO for use with refractory linings comprised of MgO based refractory brick. |
| FILED | Friday, October 26, 2012 |
| APPL NO | 13/661170 |
| ART UNIT | 1732 — Metallurgy, Metal Working, Inorganic Chemistry, Catalyst, Electrophotography, Photolithography |
| CURRENT CPC | Compositions 252/373 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703023 | Sainsbury et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Toby Sainsbury (Dublin, Ireland); Takashi Ikuno (Aichi, Japan); Alexander K. Zettl (Kensington, California) |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Toby Sainsbury (Dublin, Ireland); Takashi Ikuno (Aichi, Japan); Alexander K. Zettl (Kensington, California) |
| ABSTRACT | A plasma treatment has been used to modify the surface of BNNTs. In one example, the surface of the BNNT has been modified using ammonia plasma to include amine functional groups. Amine functionalization allows BNNTs to be soluble in chloroform, which had not been possible previously. Further functionalization of amine-functionalized BNNTs with thiol-terminated organic molecules has also been demonstrated. Gold nanoparticles have been self-assembled at the surface of both amine- and thiol-functionalized boron nitride Nanotubes (BNNTs) in solution. This approach constitutes a basis for the preparation of highly functionalized BNNTs and for their utilization as nanoscale templates for assembly and integration with other nanoscale materials. |
| FILED | Tuesday, June 19, 2012 |
| APPL NO | 13/527369 |
| ART UNIT | 1767 — Organic Chemistry, Polymers, Compositions |
| CURRENT CPC | Compositions 252/500 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703058 | Hatch et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Anson V. Hatch (Tracy, California); Gregory J. Sommer (Livermore, California); Anup K. Singh (Danville, California); Ying-Chih Wang (Pleasanton, California); Vinay V. Abhyankar (Dublin, California) |
| ASSIGNEE(S) | Sandia Corporation (Albuquerque, New Mexico) |
| INVENTOR(S) | Anson V. Hatch (Tracy, California); Gregory J. Sommer (Livermore, California); Anup K. Singh (Danville, California); Ying-Chih Wang (Pleasanton, California); Vinay V. Abhyankar (Dublin, California) |
| ABSTRACT | Microfluidic devices and methods including porous polymer monoliths are described. Polymerization techniques may be used to generate porous polymer monoliths having pores defined by a liquid component of a fluid mixture. The fluid mixture may contain iniferters and the resulting porous polymer monolith may include surfaces terminated with iniferter species. Capture molecules may then be grafted to the monolith pores. |
| FILED | Wednesday, September 09, 2009 |
| APPL NO | 12/556459 |
| ART UNIT | 1772 — Chemical Apparatus, Separation and Purification, Liquid and Gas Contact Apparatus |
| CURRENT CPC | Chemical apparatus and process disinfecting, deodorizing, preserving, or sterilizing 422/69 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703310 | Mullin et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Scott Mullin (Berkeley, California); Ashoutosh Panday (Berkeley, California); Nitash Pervez Balsara (El Cerrito, California); Mohit Singh (Berkeley, California); Hany Basam Eitouni (Berkeley, California); Enrique Daniel Gomez (Princeton, New Jersey) |
| ASSIGNEE(S) | The Regents of The University of California (Oakland, California) |
| INVENTOR(S) | Scott Mullin (Berkeley, California); Ashoutosh Panday (Berkeley, California); Nitash Pervez Balsara (El Cerrito, California); Mohit Singh (Berkeley, California); Hany Basam Eitouni (Berkeley, California); Enrique Daniel Gomez (Princeton, New Jersey) |
| ABSTRACT | A polymer that combines high ionic conductivity with the structural properties required for Li electrode stability is useful as a solid phase electrolyte for high energy density, high cycle life batteries that do not suffer from failures due to side reactions and dendrite growth on the Li electrodes, and other potential applications. The polymer electrolyte includes a linear block copolymer having a conductive linear polymer block with a molecular weight of at least 5000 Daltons, a structural linear polymer block with an elastic modulus in excess of 1×107 Pa and an ionic conductivity of at least 1×10−5 Scm−1. The electrolyte is made under dry conditions to achieve the noted characteristics. In another aspect, the electrolyte exhibits a conductivity drop when the temperature of electrolyte increases over a threshold temperature, thereby providing a shutoff mechanism for preventing thermal runaway in lithium battery cells. |
| FILED | Tuesday, October 30, 2012 |
| APPL NO | 13/664345 |
| ART UNIT | 1726 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Chemistry: Electrical current producing apparatus, product, and process 429/50 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703391 | Dirk et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Shawn M. Dirk (Albuquerque, New Mexico); Roger D. Rasberry (Albuquerque, New Mexico); Kamyar Rahimian (Albuquerque, New Mexico) |
| ASSIGNEE(S) | Sandia Corporation (Albuquerque, New Mexico) |
| INVENTOR(S) | Shawn M. Dirk (Albuquerque, New Mexico); Roger D. Rasberry (Albuquerque, New Mexico); Kamyar Rahimian (Albuquerque, New Mexico) |
| ABSTRACT | A polymeric matrix material exhibits low loss at optical frequencies and facilitates the fabrication of all-dielectric metamaterials. The low-loss polymeric matrix material can be synthesized by providing an unsaturated polymer, comprising double or triple bonds; partially hydrogenating the unsaturated polymer; depositing a film of the partially hydrogenated polymer and a crosslinker on a substrate; and photopatterning the film by exposing the film to ultraviolet light through a patterning mask, thereby cross-linking at least some of the remaining unsaturated groups of the partially hydrogenated polymer in the exposed portions. |
| FILED | Tuesday, November 29, 2011 |
| APPL NO | 13/305837 |
| ART UNIT | 1722 — Fuel Cells, Battery, Flammable Gas, Solar Cells, Liquid Crystal Compositions |
| CURRENT CPC | Radiation imagery chemistry: Process, composition, or product thereof 430/311 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703523 | Biener et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Juergen Biener (San Leandro, California); Theodore F. Baumann (Discovery Bay, California); Subho Dasgupta (Eggenstein-Leopoldshafen, Germany); Horst Hahn (Seeheim-Jugenheim, Germany) |
| ASSIGNEE(S) | Lawrence Livermore National Security, LLC. (Livermore, California); Karlsruher Institut fur Technologie (KIT) (Eggenstein-Leopoldshafen, Germany) |
| INVENTOR(S) | Juergen Biener (San Leandro, California); Theodore F. Baumann (Discovery Bay, California); Subho Dasgupta (Eggenstein-Leopoldshafen, Germany); Horst Hahn (Seeheim-Jugenheim, Germany) |
| ABSTRACT | In one embodiment, a tunable resistor/transistor includes a porous material that is electrically coupled between a source electrode and a drain electrode, wherein the porous material acts as an active channel, an electrolyte solution saturating the active channel, the electrolyte solution being adapted for altering an electrical resistance of the active channel based on an applied electrochemical potential, wherein the active channel comprises nanoporous carbon arranged in a three-dimensional structure. In another embodiment, a method for forming the tunable resistor/transistor includes forming a source electrode, forming a drain electrode, and forming a monolithic nanoporous carbon material that acts as an active channel and selectively couples the source electrode to the drain electrode electrically. In any embodiment, the electrolyte solution saturating the nanoporous carbon active channel is adapted for altering an electrical resistance of the nanoporous carbon active channel based on an applied electrochemical potential. |
| FILED | Monday, December 05, 2011 |
| APPL NO | 13/311468 |
| ART UNIT | 2895 — Semiconductors/Memory |
| CURRENT CPC | Semiconductor device manufacturing: Process 438/82 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703642 | Mohajeri |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | University of Central Florida Research Foundation, Inc. (Orlando, Florida) |
| ASSIGNEE(S) | University of Central Florida Research Foundation, Inc. (Orlando, Florida) |
| INVENTOR(S) | Nahid Mohajeri (Rockledge, Florida) |
| ABSTRACT | A method of forming a supported oxidation catalyst includes providing a support comprising a metal oxide or a metal salt, and depositing first palladium compound particles and second precious metal group (PMG) metal particles on the support while in a liquid phase including at least one solvent to form mixed metal comprising particles on the support. The PMG metal is not palladium. The mixed metal particles on the support are separated from the liquid phase to provide the supported oxidation catalyst. |
| FILED | Thursday, October 24, 2013 |
| APPL NO | 14/062312 |
| ART UNIT | 1736 — Metallurgy, Metal Working, Inorganic Chemistry, Catalyst, Electrophotography, Photolithography |
| CURRENT CPC | Catalyst, solid sorbent, or support therefor: Product or process of making 52/325 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704183 | Livesay |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | UT-Battelle, LLC (Oak Ridge, Tennessee) |
| ASSIGNEE(S) | UT-Battelle, LLC (Oak Ridge, Tennessee) |
| INVENTOR(S) | Ronald Jason Livesay (Knoxville, Tennessee) |
| ABSTRACT | Described herein are adaptors and other devices for radiation detectors that can be used to make accurate spectral measurements of both small and large bulk sources of radioactivity, such as building structures, soils, vessels, large equipment, and liquid bodies. Some exemplary devices comprise an adaptor for a radiation detector, wherein the adaptor can be configured to collimate radiation passing through the adapter from an external radiation source to the radiation detector and the adaptor can be configured to enclose a radiation source within the adapter to allow the radiation detector to measure radiation emitted from the enclosed radiation source. |
| FILED | Thursday, September 20, 2012 |
| APPL NO | 13/623749 |
| ART UNIT | 2884 — Optics |
| CURRENT CPC | Measurement of Nuclear or X-radiation G01T 7/00 (20130101) Original (OR) Class |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704186 | Nelson et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Karl Einar Nelson (Livermore, California); Morgan T. Burks (Oakland, California) |
| ASSIGNEE(S) | Lawrence Livermore National Security, LLC (Livermore, California) |
| INVENTOR(S) | Karl Einar Nelson (Livermore, California); Morgan T. Burks (Oakland, California) |
| ABSTRACT | A microphonics noise cancellation system and method for improving the energy resolution for mechanically cooled high-purity Germanium (HPGe) detector systems. A classical adaptive noise canceling digital processing system using an adaptive predictor is used in an MCA to attenuate the microphonics noise source making the system more deployable. |
| FILED | Wednesday, November 17, 2010 |
| APPL NO | 12/948695 |
| ART UNIT | 2884 — Optics |
| CURRENT CPC | Radiant energy 250/370.60 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704536 | Duden |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Thomas Duden (Kensington, California) |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Thomas Duden (Kensington, California) |
| ABSTRACT | A position measuring sensor formed from opposing sets of capacitor plates measures both rotational displacement and lateral displacement from the changes in capacitances as overlapping areas of capacitors change. Capacitances are measured by a measuring circuit. The measured capacitances are provided to a calculating circuit that performs calculations to obtain angular and lateral displacement from the capacitances measured by the measuring circuit. |
| FILED | Tuesday, July 28, 2009 |
| APPL NO | 13/002762 |
| ART UNIT | 2867 — Printing/Measuring and Testing |
| CURRENT CPC | Electricity: Measuring and testing 324/658 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705215 | Darmann |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Francis Anthony Darmann (New South Wales, Australia) |
| ASSIGNEE(S) | Applied Superconductor Pty Ltd (Wollongong, Australia) |
| INVENTOR(S) | Francis Anthony Darmann (New South Wales, Australia) |
| ABSTRACT | A fault current limiter including: a ferromagnetic circuit formed from a ferromagnetic material and including at least a first limb, and a second limb; a saturation mechanism surrounding a limb for magnetically saturating the ferromagnetic material; a phase coil wound around a second limb; a dielectric fluid surrounding the phase coil; a gaseous atmosphere surrounding the saturation mechanism. |
| FILED | Thursday, November 27, 2008 |
| APPL NO | 12/740239 |
| ART UNIT | 2836 — Electrical Circuits and Systems |
| CURRENT CPC | Electricity: Electrical systems and devices 361/19 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705342 | Yu et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Dantong Yu (Stony Brook, New York); Dimitrios Katramatos (Coram, New York); Alexander Sim (San Ramon, California); Arie Shoshani (Berkeley, California) |
| ASSIGNEE(S) | Brookhaven Science Associates, LLC (Upton, New York) |
| INVENTOR(S) | Dantong Yu (Stony Brook, New York); Dimitrios Katramatos (Coram, New York); Alexander Sim (San Ramon, California); Arie Shoshani (Berkeley, California) |
| ABSTRACT | A cross-domain network resource reservation scheduler configured to schedule a path from at least one end-site includes a management plane device configured to monitor and provide information representing at least one of functionality, performance, faults, and fault recovery associated with a network resource; a control plane device configured to at least one of schedule the network resource, provision local area network quality of service, provision local area network bandwidth, and provision wide area network bandwidth; and a service plane device configured to interface with the control plane device to reserve the network resource based on a reservation request and the information from the management plane device. Corresponding methods and computer-readable medium are also disclosed. |
| FILED | Friday, October 14, 2011 |
| APPL NO | 13/273541 |
| ART UNIT | 2478 — Multiplex and VoIP |
| CURRENT CPC | Multiplex communications 370/216 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705681 | Srivastava et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Suresh C. Srivastava (Setauket, New York); Boris Leonidovich Zhuikov (Moscow region, Russian Federation); Stanislav Victorovich Ermolaev (Moscow region, Russian Federation); Nikolay Alexandrovich Konyakhin (Kaluga region, Russian Federation); Vladimir Mikhailovich Kokhanyuk (Moscow region, Russian Federation); Stepan Vladimirovich Khamyanov (Kaluga region, Russian Federation); Natalya Roaldovna Togaeva (Kaluga region, Russian Federation) |
| ASSIGNEE(S) | Brookhaven Science Associates, LLC (, None) |
| INVENTOR(S) | Suresh C. Srivastava (Setauket, New York); Boris Leonidovich Zhuikov (Moscow region, Russian Federation); Stanislav Victorovich Ermolaev (Moscow region, Russian Federation); Nikolay Alexandrovich Konyakhin (Kaluga region, Russian Federation); Vladimir Mikhailovich Kokhanyuk (Moscow region, Russian Federation); Stepan Vladimirovich Khamyanov (Kaluga region, Russian Federation); Natalya Roaldovna Togaeva (Kaluga region, Russian Federation) |
| ABSTRACT | One embodiment of the present invention includes a process for production and recovery of no-carrier-added radioactive tin (NCA radiotin). An antimony target can be irradiated with a beam of accelerated particles forming NCA radiotin, followed by separation of the NCA radiotin from the irradiated target. The target is metallic Sb in a hermetically sealed shell. The shell can be graphite, molybdenum, or stainless steel. The irradiated target can be removed from the shell by chemical or mechanical means, and dissolved in an acidic solution. Sb can be removed from the dissolved irradiated target by extraction. NCA radiotin can be separated from the remaining Sb and other impurities using chromatography on silica gel sorbent. NCA tin-117m can be obtained from this process. NCA tin-117m can be used for labeling organic compounds and biological objects to be applied in medicine for imaging and therapy of various diseases. |
| FILED | Friday, December 21, 2007 |
| APPL NO | 11/962851 |
| ART UNIT | 3646 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Induced nuclear reactions: Processes, systems, and elements 376/190 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705682 | Moen et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Stephan Craig Moen (Wilmington, North Carolina); Jack Patrick Noonan (Wilmington, North Carolina); Pradip Saha (Wilmington, North Carolina) |
| ASSIGNEE(S) | GE-Hitachi Nuclear Energy Americas LLC (Wilmington, North Carolina) |
| INVENTOR(S) | Stephan Craig Moen (Wilmington, North Carolina); Jack Patrick Noonan (Wilmington, North Carolina); Pradip Saha (Wilmington, North Carolina) |
| ABSTRACT | A system for controlling the power level of a natural circulation boiling water nuclear reactor (NCBWR) is disclosed. The system, in accordance with an example embodiment of the present invention, may include a controller configured to control a power output level of the NCBWR by controlling a heating subsystem to adjust a temperature of feedwater flowing into an annulus of the NCBWR. The heating subsystem may include a steam diversion line configured to receive steam generated by a core of the NCBWR and a steam bypass valve configured to receive commands from the controller to control a flow of the steam in the steam diversion line, wherein the steam received by the steam diversion line has not passed through a turbine. Additional embodiments of the invention may include a feedwater bypass valve for controlling an amount of flow of the feedwater through a heater bypass line to the annulus. |
| FILED | Friday, July 13, 2007 |
| APPL NO | 11/777377 |
| ART UNIT | 4187 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Induced nuclear reactions: Processes, systems, and elements 376/207 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705890 | Dowell |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Larry Jonathan Dowell (Los Alamos, New Mexico) |
| ASSIGNEE(S) | Los Alamos National Security, LLC (Los Alamos, New Mexico) |
| INVENTOR(S) | Larry Jonathan Dowell (Los Alamos, New Mexico) |
| ABSTRACT | Disclosed is a method and device for aligning at least two digital images. An embodiment may use frequency-domain transforms of small tiles created from each image to identify substantially similar, “distinguishing” features within each of the images, and then align the images together based on the location of the distinguishing features. To accomplish this, an embodiment may create equal sized tile sub-images for each image. A “key” for each tile may be created by performing a frequency-domain transform calculation on each tile. A information-distance difference between each possible pair of tiles on each image may be calculated to identify distinguishing features. From analysis of the information-distance differences of the pairs of tiles, a subset of tiles with high discrimination metrics in relation to other tiles may be located for each image. The subset of distinguishing tiles for each image may then be compared to locate tiles with substantially similar keys and/or information-distance metrics to other tiles of other images. Once similar tiles are located for each image, the images may be aligned in relation to the identified similar tiles. |
| FILED | Monday, May 02, 2011 |
| APPL NO | 13/098578 |
| ART UNIT | 2669 — Image Analysis; Applications; Pattern Recognition; Color and compression; Enhancement and Transformation |
| CURRENT CPC | Image analysis 382/284 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706652 | Yang et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Lei Yang (Sunnydale, California); Robert P. Dick (Chelsea, Michigan); Xi Chen (San Jose, California); Gokhan Memik (Evanston, Illinois); Peter A. Dinda (Evanston, Illinois); Alex Shye (Evanston, Illinois); Berkin Ozisikyilmaz (Chicago, Illinois); Arindam Mallik (Leuven, Belgium); Alok Choudhary (Chicago, Illinois) |
| ASSIGNEE(S) | Northwestern University (Evanston, Illinois) |
| INVENTOR(S) | Lei Yang (Sunnydale, California); Robert P. Dick (Chelsea, Michigan); Xi Chen (San Jose, California); Gokhan Memik (Evanston, Illinois); Peter A. Dinda (Evanston, Illinois); Alex Shye (Evanston, Illinois); Berkin Ozisikyilmaz (Chicago, Illinois); Arindam Mallik (Leuven, Belgium); Alok Choudhary (Chicago, Illinois) |
| ABSTRACT | Systems and methods for controlling power consumption in a computer system. For each of a plurality of interactive applications, the method changes a frequency at which a processor of the computer system runs, receives an indication of user satisfaction, determines a relationship between the changed frequency and the user satisfaction of the interactive application, and stores the determined relationship information. The determined relationship can distinguish between different users and different interactive applications. A frequency may be selected from the discrete frequencies at which the processor of the computer system runs based on the determined relationship information for a particular user and a particular interactive application running on the processor of the computer system. The processor may be adapted to run at the selected frequency. |
| FILED | Wednesday, June 09, 2010 |
| APPL NO | 12/796934 |
| ART UNIT | 2122 — AI & Simulation/Modeling |
| CURRENT CPC | Data processing: Artificial intelligence 76/12 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706832 | Blocksome |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | International Business Machines Corporation (Armonk, New York) |
| ASSIGNEE(S) | International Business Machines Corporation (Armonk, New York) |
| INVENTOR(S) | Michael A. Blocksome (Rochester, Minnesota) |
| ABSTRACT | Methods, systems, and products are disclosed for data transfers between nodes in a parallel computer that include: receiving, by an origin DMA on an origin node, a buffer identifier for a buffer containing data for transfer to a target node; sending, by the origin DMA to the target node, a RTS message; transferring, by the origin DMA, a data portion to the target node using a memory FIFO operation that specifies one end of the buffer from which to begin transferring the data; receiving, by the origin DMA, an acknowledgement of the RTS message from the target node; and transferring, by the origin DMA in response to receiving the acknowledgement, any remaining data portion to the target node using a direct put operation that specifies the other end of the buffer from which to begin transferring the data, including initiating the direct put operation without invoking an origin processing core. |
| FILED | Monday, February 18, 2013 |
| APPL NO | 13/769715 |
| ART UNIT | 2491 — Cryptography and Security |
| CURRENT CPC | Electrical computers and digital processing systems: Multicomputer data transferring 79/212 |
| VIEW PATENT | @ USPTO: Full Text PDF |
National Aeronautics and Space Administration (NASA)
| US 08702938 | Srinivasan et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Vijay Srinivasan (Durham, North Carolina); Michael G. Pollack (Durham, North Carolina); Alexander Shenderov (Raleigh, North Carolina); Zhishan Hua (Durham, North Carolina); Arjun Sudarsan (Cary, North Carolina) |
| ASSIGNEE(S) | Advanced Liquid Logic, Inc. (Morrisville, North Carolina) |
| INVENTOR(S) | Vijay Srinivasan (Durham, North Carolina); Michael G. Pollack (Durham, North Carolina); Alexander Shenderov (Raleigh, North Carolina); Zhishan Hua (Durham, North Carolina); Arjun Sudarsan (Cary, North Carolina) |
| ABSTRACT | The invention provides a droplet actuator comprising a base substrate and a top substrate separated to form a gap, wherein: (a) the base substrate comprises electrodes configured for conducting droplet operations in the gap; and (b) the top substrate comprises a first portion coupled to second portion, where the second portion comprises one or more openings establishing a fluid path extending from an exterior of the droplet actuator and into the gap. The invention also provides related methods of manufacturing the droplet actuator, methods of using the droplet actuator, and methods of loading the droplet actuator. |
| FILED | Thursday, September 04, 2008 |
| APPL NO | 12/676384 |
| ART UNIT | 1759 — Tires, Adhesive Bonding, Glass/Paper making, Plastics Shaping & Molding |
| CURRENT CPC | Chemistry: Electrical and wave energy 24/450 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08702962 | Hunter et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Gary W. Hunter (Oberlin, Ohio); Jennifer C. Xu (Olmsted Township, Ohio) |
| ASSIGNEE(S) | The United States of America as Represented by the Administrator of National Aeronautics and Space Administration (Washington, District of Columbia) |
| INVENTOR(S) | Gary W. Hunter (Oberlin, Ohio); Jennifer C. Xu (Olmsted Township, Ohio) |
| ABSTRACT | A gas sensor comprises a substrate layer; a pair of interdigitated metal electrodes, said electrodes include upper surfaces, the electrodes selected from the group consisting of Pt, Pd, Au, Ir, Ag, Ru, Rh, In, Os, and their alloys. A first layer of solid electrolyte staying in between electrode fingers and partially on said upper surfaces of said electrodes, said first layer selected from NASICON, LISICON, KSICON and β″-Alumina. A second layer of metal carbonate(s) as an auxiliary electrolyte engaging said upper surfaces of the electrodes and the first solid electrolyte. The metal carbonates selected from the group consisting of the following ions Na+, K+, Li+, Ag+, H+, Pb2+, Sr2+, Ba2+, and any combination thereof. An extra layer of metal oxide selected from the group consisting of SnO2, In2O3, TiO2, WO3, ZnO, Fe2O3, ITO, CdO, U3O8, Ta2O5, BaO, MoO2, MoO3, V2O5, Nb2O5, CuO, Cr2O3, La2O3, RuO3, RuO2, ReO2, ReO3, Ag2O, CoO, Cu2O, SnO, NiO, Pr2O3, BaO, PdO2, HfO3, HfO3 or other metal oxide and their mixtures residing above and in engagement with the second electrolyte to improve sensor performance and/or to reduce sensor heating power consumption. |
| FILED | Wednesday, August 20, 2008 |
| APPL NO | 12/195358 |
| ART UNIT | 1759 — Tires, Adhesive Bonding, Glass/Paper making, Plastics Shaping & Molding |
| CURRENT CPC | Electrolysis: Processes, compositions used therein, and methods of preparing the compositions 25/784 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703235 | Southward et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Robin E. Southward (Stanwood, Washington); Donavon Mark Delozier (Disputanta, Virginia); Kent A. Watson (New Kent, Virginia); Joseph G. Smith (Smithfield, Virginia); Sayata Ghose (Newport News, Virginia); John W. Connell (Yorktown, Virginia) |
| ASSIGNEE(S) | The United States of America as represented by the Administrator of the National Aeronautics and Space Administration (Washington, District of Columbia) |
| INVENTOR(S) | Robin E. Southward (Stanwood, Washington); Donavon Mark Delozier (Disputanta, Virginia); Kent A. Watson (New Kent, Virginia); Joseph G. Smith (Smithfield, Virginia); Sayata Ghose (Newport News, Virginia); John W. Connell (Yorktown, Virginia) |
| ABSTRACT | In the method of embodiments of the invention, the metal seeded carbon allotropes are reacted in solution forming zero valent metallic nanowires at the seeded sites. A polymeric passivating reagent, which selects for anisotropic growth is also used in the reaction to facilitate nanowire formation. The resulting structure resembles a porcupine, where carbon allotropes have metallic wires of nanometer dimensions that emanate from the seed sites on the carbon allotrope. These sites are populated by nanowires having approximately the same diameter as the starting nanoparticle diameter. |
| FILED | Friday, April 08, 2011 |
| APPL NO | 13/082734 |
| ART UNIT | 1788 — Miscellaneous Articles, Stock Material |
| CURRENT CPC | Coating processes 427/215 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704423 | Stewart |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Brian K. Stewart (Hayes, Virginia) |
| ASSIGNEE(S) | The United States of America as represented by the Administrator of the National Aeronautics and Space Administration (Washington, District of Columbia) |
| INVENTOR(S) | Brian K. Stewart (Hayes, Virginia) |
| ABSTRACT | Embodiments of the invention provide a dielectric elastomer composite material comprising a plurality of elastomer-coated electrodes arranged in an assembly. Embodiments of the invention provide improved force output over prior DEs by producing thinner spacing between electrode surfaces. This is accomplished by coating electrodes directly with uncured elastomer in liquid form and then assembling a finished component (which may be termed an actuator) from coated electrode components. |
| FILED | Wednesday, August 19, 2009 |
| APPL NO | 12/543686 |
| ART UNIT | 2834 — Electrical Circuits and Systems |
| CURRENT CPC | Electrical generator or motor structure 310/309 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704654 | Krasowski et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Michael J. Krasowski (Chagrin Falls, Ohio); Norman F. Prokop (South Euclid, Ohio) |
| ASSIGNEE(S) | The United States of America as Represented by the Administrator of National Aeronautics and Space Administration (Washington, District of Columbia) |
| INVENTOR(S) | Michael J. Krasowski (Chagrin Falls, Ohio); Norman F. Prokop (South Euclid, Ohio) |
| ABSTRACT | A high temperature communications circuit includes a power conductor for concurrently conducting electrical energy for powering circuit components and transmitting a modulated data signal, and a demodulator for demodulating the data signal and generating a serial bit stream based on the data signal. The demodulator includes an absolute value amplifier for conditionally inverting or conditionally passing a signal applied to the absolute value amplifier. The absolute value amplifier utilizes no diodes to control the conditional inversion or passing of the signal applied to the absolute value amplifier. |
| FILED | Thursday, June 07, 2007 |
| APPL NO | 11/759570 |
| ART UNIT | 2684 — Telemetry and Code Generation Vehicles and System Alarms |
| CURRENT CPC | Communications: Electrical 340/538 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706299 | Sanders et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Adam M. Sanders (Holly, Michigan); Robert J. Platt, Jr. (Cambridge, Massachusetts); Nathaniel Quillin (League City, Texas); Frank Noble Permenter (Webster, Texas); Joseph Pfeiffer (Las Cruses, New Mexico) |
| ASSIGNEE(S) | GM Global Technology Operations LLC (Detroit, Michigan); The United States of America as Represented by the Administrator of the National Aeronautics and Space Administration (Washington, District of Columbia) |
| INVENTOR(S) | Adam M. Sanders (Holly, Michigan); Robert J. Platt, Jr. (Cambridge, Massachusetts); Nathaniel Quillin (League City, Texas); Frank Noble Permenter (Webster, Texas); Joseph Pfeiffer (Las Cruses, New Mexico) |
| ABSTRACT | A robotic system includes a dexterous robot and a controller. The robot includes a plurality of robotic joints, actuators for moving the joints, and sensors for measuring a characteristic of the joints, and for transmitting the characteristics as sensor signals. The controller receives the sensor signals, and is configured for executing instructions from memory, classifying the sensor signals into distinct classes via the state classification module, monitoring a system state of the robot using the classes, and controlling the robot in the execution of alternative work tasks based on the system state. A method for controlling the robot in the above system includes receiving the signals via the controller, classifying the signals using the state classification module, monitoring the present system state of the robot using the classes, and controlling the robot in the execution of alternative work tasks based on the present system state. |
| FILED | Tuesday, August 02, 2011 |
| APPL NO | 13/196252 |
| ART UNIT | 3664 — Computerized Vehicle Controls and Navigation, Radio Wave, Optical and Acoustic Wave Communication, Robotics, and Nuclear Systems |
| CURRENT CPC | Data processing: Generic control systems or specific applications 7/258 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Small Business Administration (SBA)
| US 08703022 | Svoboda et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Vojtech Svoboda (Huntsville, Alabama); Jianjun Wei (Huntsville, Alabama); Sameer Singhal (Huntsville, Alabama) |
| ASSIGNEE(S) | CFD Research Corporation (Huntsville, Alabama) |
| INVENTOR(S) | Vojtech Svoboda (Huntsville, Alabama); Jianjun Wei (Huntsville, Alabama); Sameer Singhal (Huntsville, Alabama) |
| ABSTRACT | The present disclosure provides an aqueous based electrically conductive ink, which is essentially solvent free and includes a nano-scale conducting material; a binding agent; and an enzyme. In one embodiment, the ink includes at least one of a mediator, a cross-linking agent and a substrate as well. In one further embodiment, the present disclosure provides electrically conductive ink including a single walled, carboxylic acid functionalized carbon nanotube; 1-Ethyl-3-[3-dimethylaminopropyl]carbodiimide hydrochloride and N-hydroxy succinimide (NHS) ester; polyethyleneimine; an aqueous buffer; and glucose oxidase. |
| FILED | Wednesday, June 08, 2011 |
| APPL NO | 13/155811 |
| ART UNIT | 1766 — Organic Chemistry, Polymers, Compositions |
| CURRENT CPC | Compositions 252/500 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703717 | Schellenberger et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Volker Schellenberger (Palo Alto, California); Joshua Silverman (Sunnyvale, California); Chia-wei Wang (Milpitas, California); Willem P. Stemmer (Los Gatos, California); Nathan Geething (Santa Clara, California); Jeffrey L. Cleland (San Carlos, California) |
| ASSIGNEE(S) | Amunix Operating Inc. (Mountain View, California) |
| INVENTOR(S) | Volker Schellenberger (Palo Alto, California); Joshua Silverman (Sunnyvale, California); Chia-wei Wang (Milpitas, California); Willem P. Stemmer (Los Gatos, California); Nathan Geething (Santa Clara, California); Jeffrey L. Cleland (San Carlos, California) |
| ABSTRACT | The present invention relates to compositions comprising growth hormone linked to extended recombinant polypeptide (XTEN), isolated nucleic acids encoding the compositions and vectors and host cells containing the same, and methods of making and using such compositions in treatment of growth hormone-related diseases, disorders, and conditions. |
| FILED | Tuesday, June 08, 2010 |
| APPL NO | 12/796640 |
| ART UNIT | 1654 — Fermentation, Microbiology, Isolated and Recombinant Proteins/Enzymes |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 514/21.200 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704351 | Gibson et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | David Gibson (San Jose, California); Andy Stavros (San Jose, California) |
| ASSIGNEE(S) | Tessera, Inc. (San Jose, California) |
| INVENTOR(S) | David Gibson (San Jose, California); Andy Stavros (San Jose, California) |
| ABSTRACT | A microelectronic assembly includes units superposed on one another to form at least one stack having a vertical direction. Each unit includes one or more microelectronic devices and has top and bottom surfaces. Top unit terminals are exposed at the top surfaces and bottom unit terminals are exposed at the bottom surfaces. The top and bottom unit terminals are provided at a set of ordered column positions. Each top unit terminal of the set, except the top unit terminals at the highest ordered column position, is connected to a respective bottom unit terminal of the same unit at a next higher ordered column position. Each bottom unit terminal of the set, except the bottom unit terminals of the lowest unit in the stack, is connected to a respective upper unit terminal of the next lower unit in the stack at the same column position. |
| FILED | Tuesday, September 01, 2009 |
| APPL NO | 12/551807 |
| ART UNIT | 2897 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/686 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705032 | Herzinger et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Craig M. Herzinger (Lincoln, Nebraska); Mathias M. Schubert (Lincoln, Nebraska); Tino Hofmann (Lincoln, Nebraska); Martin M. Liphardt (Lincoln, Nebraska); John A. Woollam (Lincoln, Nebraska) |
| ASSIGNEE(S) | J.A. Woollam Co., Inc (Lincoln, Nebraska) |
| INVENTOR(S) | Craig M. Herzinger (Lincoln, Nebraska); Mathias M. Schubert (Lincoln, Nebraska); Tino Hofmann (Lincoln, Nebraska); Martin M. Liphardt (Lincoln, Nebraska); John A. Woollam (Lincoln, Nebraska) |
| ABSTRACT | The present invention relates to ellipsometer and polarimeter systems, and more particularly is an ellipsometer or polarimeter or the like system which operates in a frequency range between 300 GHz or lower and extending to higher than at least 1 Tera-hertz (THz), and preferably through the Infra-red (IR) range up to, and higher than 100 THz, including: a source such as a backward wave oscillator; a Smith-Purcell cell; a free electron laser, or an FTIR source and a solid state device; and a detector such as a Golay cell; a bolometer or a solid state detector; and preferably including a polarization state generator comprising: an odd bounce image rotating system and a polarizer, or two polarizers; and optionally including least one compensator and/or modulator, in addition to an analyzer. |
| FILED | Thursday, March 07, 2013 |
| APPL NO | 13/815487 |
| ART UNIT | 2886 — Optics |
| CURRENT CPC | Optics: Measuring and testing 356/364 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Commerce (DOC)
| US 08705793 | Nevatia et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ramakant Nevatia (Pacific Palisades, California); Chang Huang (Los Angeles, California); Bo Wu (Mountain View, California) |
| ASSIGNEE(S) | University of Southern California (Los Angeles, California) |
| INVENTOR(S) | Ramakant Nevatia (Pacific Palisades, California); Chang Huang (Los Angeles, California); Bo Wu (Mountain View, California) |
| ABSTRACT | Systems, methods, and computer readable storage media are described that can provide a multi-level hierarchical framework to progressively associate detection responses, in which different methods and models are adopted to improve tracking robustness. A modified transition matrix for the Hungarian algorithm can be used to solve the association problem that considers not only initialization, termination and transition of tracklets but also false alarm hypotheses. A Bayesian inference approach can be used to automatically estimate a scene structure model as the high-level knowledge for the long-range trajectory association. |
| FILED | Friday, October 08, 2010 |
| APPL NO | 12/901316 |
| ART UNIT | 2665 — Image Analysis; Applications; Pattern Recognition; Color and compression; Enhancement and Transformation |
| CURRENT CPC | Image analysis 382/103 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706735 | Morton et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Streamsage, Inc. (Washington, District of Columbia) |
| ASSIGNEE(S) | Streamsage, Inc. (Washington, District of Columbia) |
| INVENTOR(S) | Michael Scott Morton (Washington, District of Columbia); Sibley Verbeck Simon (Washington, District of Columbia); Noam Carl Unger (Somerville, Massachusetts); Robert Rubinoff (Potomac, Maryland); Anthony Ruiz Davis (Takoma Park, Maryland); Kyle Aveni-Deforge (Columbia, South Carolina) |
| ABSTRACT | A method and system for indexing, searching, and retrieving information from timed media files based upon relevance intervals. The method and system for indexing, searching, and retrieving this information is based upon relevance intervals so that a portion of a timed media file is returned, which is selected specifically to be relevant to the given information representations, thereby eliminating the need for a manual determination of the relevance and avoiding missing relevant portions. The timed media includes streaming audio, streaming video, timed HTML, animations such as vector-based graphics, slide shows, other timed media, and combinations thereof. |
| FILED | Wednesday, July 31, 2013 |
| APPL NO | 13/955582 |
| ART UNIT | 2155 — Data Bases & File Management |
| CURRENT CPC | Data processing: Database and file management or data structures 77/746 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08707224 | Peralta et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Rene Caupolican Peralta (Gaithersburg, Maryland); Joan Boyar (Odense N, Denmark) |
| ASSIGNEE(S) | The United States of America, as Represented by the Secretary of Commerce, The National Institute of Standards and Technology (Washington, District of Columbia); University of Southern Denmark (Odense M, Denmark) |
| INVENTOR(S) | Rene Caupolican Peralta (Gaithersburg, Maryland); Joan Boyar (Odense N, Denmark) |
| ABSTRACT | A method of simplifying a combinational circuit establishes an initial combinational circuit operable to calculate a set of target signals. A quantity of multiplication operations performed in a first portion of the initial combinational circuit is reduced to create a first, simplified combinational circuit. The first portion includes only multiplication operations and addition operations. A quantity of addition operations performed in a second portion of the first, simplified combinational circuit is reduced to create a second, simplified combinational circuit. The second portion includes only addition operations. Also, the second, simplified combinational circuit is operable to calculate the target signals using fewer operations than the initial combinational circuit. |
| FILED | Friday, September 14, 2012 |
| APPL NO | 13/615795 |
| ART UNIT | 2851 — Printing/Measuring and Testing |
| CURRENT CPC | Computer-aided design and analysis of circuits and semiconductor masks 716/101 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Homeland Security (DHS)
| US 08703653 | Scaboo et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Kris Scaboo (Castro Valley, California); Patrick Martin (San Carlos, California); Brad Taft (San Francisco, California); Jason La (San Francisco, California) |
| ASSIGNEE(S) | NVS Technologies, Inc. (Menlo Park, California) |
| INVENTOR(S) | Kris Scaboo (Castro Valley, California); Patrick Martin (San Carlos, California); Brad Taft (San Francisco, California); Jason La (San Francisco, California) |
| ABSTRACT | This invention provides methods of detecting and quantifying target nucleic acids in samples in multiplexed single chamber reactions. Consumables incorporating chambers optimized to reduce signal background proximal to high efficiency arrays are provided, as well as methods of use. Devices and systems configured to use the consumables to practice the methods are a feature of the invention. |
| FILED | Thursday, August 16, 2012 |
| APPL NO | 13/587883 |
| ART UNIT | 1639 — Molecular Biology, Bioinformatics, Nucleic Acids, Recombinant DNA and RNA, Gene Regulation, Nucleic Acid Amplification, Animals and Plants, Combinatorial/ Computational Chemistry |
| CURRENT CPC | Combinatorial chemistry technology: Method, library, apparatus 56/9 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08706414 | Funk et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Benjamin E. Funk (Silver Spring, Maryland); Amrit Bandyopadhyay (Greenbelt, Maryland); Eric A. Kohn (Washington, District of Columbia); Neil Goldsman (Takoma Park, Maryland); Carole A. Teolis (Glendale, Maryland); Gilmer L. Blankeship (Washington, District of Columbia) |
| ASSIGNEE(S) | TRX Systems, Inc. (Greenbelt, Maryland) |
| INVENTOR(S) | Benjamin E. Funk (Silver Spring, Maryland); Amrit Bandyopadhyay (Greenbelt, Maryland); Eric A. Kohn (Washington, District of Columbia); Neil Goldsman (Takoma Park, Maryland); Carole A. Teolis (Glendale, Maryland); Gilmer L. Blankeship (Washington, District of Columbia) |
| ABSTRACT | The invention is directed to methods and systems for locating and monitoring the status of people and moveable assets, such as first responders, including firefighters and other public service personnel, and their equipment both indoors and out. The invention provides for locating and monitoring the status of people and assets in environments where GPS systems do not operate, or where operation is impaired or otherwise limited. The system and method uses inertial navigation to determine the location, motion and orientation of the personnel or assets and communicates with an external monitoring station to receive requests for location, motion orientation and status information and to transmit the location, motion orientation and status information to the monitoring station. |
| FILED | Friday, September 14, 2012 |
| APPL NO | 13/616323 |
| ART UNIT | 3667 — Computerized Vehicle Controls and Navigation, Radio Wave, Optical and Acoustic Wave Communication, Robotics, and Nuclear Systems |
| CURRENT CPC | Data processing: Vehicles, navigation, and relative location 71/495 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Justice (DOJ)
| US 08706426 | Sigman et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Michael Sigman (Oviedo, Florida); Mary Williams (Eustis, Florida) |
| ASSIGNEE(S) | University of Central Florida Research Foundation, Inc. (Orlando, Florida) |
| INVENTOR(S) | Michael Sigman (Oviedo, Florida); Mary Williams (Eustis, Florida) |
| ABSTRACT | In one embodiment, a system and a method for identifying the class of a component of a mixture includes collecting samples from a sample source, determining a summed ion spectrum for each sample and generating sample data from the summed ion spectra, comparing the sample data with reference summed ion spectra of multiple reference substances to determine correlations between the reference substances and the sample data, and evaluating the correlations of the substances of each substance class to determine which substance class most closely correlates to the sample data. |
| FILED | Monday, April 18, 2011 |
| APPL NO | 13/088980 |
| ART UNIT | 2857 — Printing/Measuring and Testing |
| CURRENT CPC | Investigating or Analysing Materials by Determining Their Chemical or Physical Properties G01N 31/00 (20130101) Original (OR) Class |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08707180 | Butler et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Randy L. Butler (Deland, Illinois); L. Bradlee Sheafe (Monticello, Illinois); Von Welch (Champaign, Illinois) |
| ASSIGNEE(S) | The Board of Trustees of the University of Illinois (Urbana, Illinois) |
| INVENTOR(S) | Randy L. Butler (Deland, Illinois); L. Bradlee Sheafe (Monticello, Illinois); Von Welch (Champaign, Illinois) |
| ABSTRACT | A system for executing a cyber investigation by a non-expert user, including a computer having a processor, a memory, and a display; a computer-readable medium having stored thereon instructions for execution of a wizard application, the processor adapted to execute the instructions when the computer-readable medium is inserted into the computer, the processor programmed to: receive case information; receive a type of activity being investigated in response to user inputs to select the activity type from a list of possible activity types; guide the user through capturing data related to the selected activity type through steps presented to the user through one or more screens shown in the display, the steps presented such that a non-expert user can follow them; receive user inputs through a screens to obtain information needed to continue capturing the data related to the selected activity; and store the captured data in a removable data storage device or medium for analysis and use in the cyber investigation. |
| FILED | Tuesday, August 17, 2010 |
| APPL NO | 12/857979 |
| ART UNIT | 2175 — Graphical User Interface and Document Processing |
| CURRENT CPC | Data processing: Presentation processing of document, operator interface processing, and screen saver display processing 715/709 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Environmental Protection Agency (EPA)
| US 08702897 | Lin et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Wei Lin (Atlanta, Georgia); Ching Ping Wong (Berkeley Lake, Georgia) |
| ASSIGNEE(S) | Georgia Tech Research Corporation (Atlanta, Georgia) |
| INVENTOR(S) | Wei Lin (Atlanta, Georgia); Ching Ping Wong (Berkeley Lake, Georgia) |
| ABSTRACT | Embodiments of the present disclosure include structures including a layer of carbon nanotubes, methods of making structures including a layer of carbon nanotubes, and the like. |
| FILED | Wednesday, May 26, 2010 |
| APPL NO | 12/800934 |
| ART UNIT | 1746 — Tires, Adhesive Bonding, Glass/Paper making, Plastics Shaping & Molding |
| CURRENT CPC | Adhesive bonding and miscellaneous chemical manufacture 156/322 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08703140 | Holers et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | V. Michael Holers (Denver, Colorado); Joshua M. Thurman (Greenwood Village, Colorado); Christian Taube (Denver, Colorado); Erwin W. Gelfand (Englewood, Colorado); Gary Gilkeson (Charleston, South Carolina) |
| ASSIGNEE(S) | MUSC Foundation for Research Development (Charleston, South Carolina); National Jewish Health (Denver, Colorado); The Regents of the University of Colorado, a body corporate (Denver, Colorado) |
| INVENTOR(S) | V. Michael Holers (Denver, Colorado); Joshua M. Thurman (Greenwood Village, Colorado); Christian Taube (Denver, Colorado); Erwin W. Gelfand (Englewood, Colorado); Gary Gilkeson (Charleston, South Carolina) |
| ABSTRACT | Disclosed are novel inhibitors of the alternative complement pathway and particularly, novel anti-factor B antibodies. Also disclosed is the use of such inhibitors to reduce or prevent airway hyperresponsiveness and/or airway inflammation by selectively inhibiting the alternative complement pathway, thereby treating diseases in which such conditions play a role. Also disclosed is the use of such inhibitors to reduce or prevent other diseases and conditions, including ischemia-reperfusion injury, by inhibition of the alternative complement pathway. |
| FILED | Wednesday, August 22, 2007 |
| APPL NO | 11/843617 |
| ART UNIT | 1644 — Immunology, Receptor/Ligands, Cytokines Recombinant Hormones, and Molecular Biology |
| CURRENT CPC | Drug, bio-affecting and body treating compositions 424/145.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Agriculture (USDA)
| US 08704044 | Gallie et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Daniel R. Gallie (Riverside, California); Todd E. Young (Palm Springs, California) |
| ASSIGNEE(S) | The Regents of the University of California (Oakland, California) |
| INVENTOR(S) | Daniel R. Gallie (Riverside, California); Todd E. Young (Palm Springs, California) |
| ABSTRACT | The present invention is directed to plant genetic engineering. In particular, it is directed to producing green leaves in maize through inhibition of ethylene. The genes involved in producing this phenotype include 1-Aminocyclopropane-1-Carboxylate (“ACC”) synthase, ACC oxidase, ACC deaminase, ethylene response sensor (“ERS”), ethylene resistant (“ETR”), and ethylene insensitive (“EIN”). |
| FILED | Monday, March 19, 2007 |
| APPL NO | 11/688162 |
| ART UNIT | 1638 — Organic Chemistry |
| CURRENT CPC | Multicellular living organisms and unmodified parts thereof and related processes 8/298 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Department of Transportation (USDOT)
| US 08703090 | Tour et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | James M. Tour (Bellaire, Texas); Dmitry V. Kosynkin (Houston, Texas); Amanda Higginbotham (Los Alamos, New Mexico); Brandi Katherine Price (Houston, Texas) |
| ASSIGNEE(S) | William Marsh Rice University (Houston, Texas) |
| INVENTOR(S) | James M. Tour (Bellaire, Texas); Dmitry V. Kosynkin (Houston, Texas); Amanda Higginbotham (Los Alamos, New Mexico); Brandi Katherine Price (Houston, Texas) |
| ABSTRACT | Methods for producing macroscopic quantities of oxidized graphene nanoribbons are disclosed herein. The methods include providing a plurality of carbon nanotubes and reacting the plurality of carbon nanotubes with at least one oxidant to form oxidized graphene nanoribbons. The at least one oxidant is operable to longitudinally open the carbon nanotubes. In some embodiments, the reacting step takes place in the presence of at least one acid. In some embodiments, the reacting step takes place in the presence of at least one protective agent. Various embodiments of the present disclosure also include methods for producing reduced graphene nanoribbons by reacting oxidized graphene nanoribbons with at least one reducing agent. Oxidized graphene nanoribbons, reduced graphene nanoribbons and compositions and articles derived therefrom are also disclosed herein. |
| FILED | Wednesday, August 19, 2009 |
| APPL NO | 12/544017 |
| ART UNIT | 1732 — Metallurgy, Metal Working, Inorganic Chemistry, Catalyst, Electrophotography, Photolithography |
| CURRENT CPC | Chemistry of inorganic compounds 423/447.100 |
| VIEW PATENT | @ USPTO: Full Text PDF |
National Geospatial Intelligence Agency (NGA)
| US 08704314 | Bozler |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Carl O. Bozler (Waltham, Massachusetts) |
| ASSIGNEE(S) | Massachusetts Institute of Technology (Cambridge, Massachusetts) |
| INVENTOR(S) | Carl O. Bozler (Waltham, Massachusetts) |
| ABSTRACT | A mechanical memory transistor includes a substrate having formed thereon a source region and a drain region. An oxide is formed upon a portion of the source region and upon a portion of the drain region. A pull up electrode is positioned above the substrate such that a gap is formed between the pull up electrode and the substrate. A movable gate has a first position and a second position. The movable gate is located in the gap between the pull up electrode and the substrate. The movable gate is in contact with the pull up electrode when the movable gate is in a first position and is in contact with the oxide to form a gate region when the movable gate is in the second position. The movable gate, in conjunction with the source region and the drain region and when the movable gate is in the second position, form a transistor that can be utilized as a non-volatile memory element. |
| FILED | Thursday, December 06, 2007 |
| APPL NO | 11/951535 |
| ART UNIT | 2822 — Semiconductors/Memory |
| CURRENT CPC | Active solid-state devices 257/415 |
| VIEW PATENT | @ USPTO: Full Text PDF |
Office of the Director of National Intelligence (ODNI)
| US 08705793 | Nevatia et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ramakant Nevatia (Pacific Palisades, California); Chang Huang (Los Angeles, California); Bo Wu (Mountain View, California) |
| ASSIGNEE(S) | University of Southern California (Los Angeles, California) |
| INVENTOR(S) | Ramakant Nevatia (Pacific Palisades, California); Chang Huang (Los Angeles, California); Bo Wu (Mountain View, California) |
| ABSTRACT | Systems, methods, and computer readable storage media are described that can provide a multi-level hierarchical framework to progressively associate detection responses, in which different methods and models are adopted to improve tracking robustness. A modified transition matrix for the Hungarian algorithm can be used to solve the association problem that considers not only initialization, termination and transition of tracklets but also false alarm hypotheses. A Bayesian inference approach can be used to automatically estimate a scene structure model as the high-level knowledge for the long-range trajectory association. |
| FILED | Friday, October 08, 2010 |
| APPL NO | 12/901316 |
| ART UNIT | 2665 — Image Analysis; Applications; Pattern Recognition; Color and compression; Enhancement and Transformation |
| CURRENT CPC | Image analysis 382/103 |
| VIEW PATENT | @ USPTO: Full Text PDF |
U.S. State Government
| US 08704191 | Yu et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Hongyu Yu (Tempe, Arizona); Jonathon Keith Oiler (Scottsdale, Arizona); Hugh James Barnaby (Tempe, Arizona) |
| ASSIGNEE(S) | Arizona Board of Regents, a Body Corporate of the State of Arizona, Acting for and on Behalf of Arizona State University (Scottsdale, Arizona) |
| INVENTOR(S) | Hongyu Yu (Tempe, Arizona); Jonathon Keith Oiler (Scottsdale, Arizona); Hugh James Barnaby (Tempe, Arizona) |
| ABSTRACT | The present invention relates generally to the detection of high energy radiation. The present invention relates more particularly to the film bulk acoustic wave resonator-based devices, and their use in the detection of high energy radiation. One aspect of the invention is a method for detecting high energy radiation, the method comprising providing a film bulk acoustic wave resonator having a zinc oxide piezoelectric layer in substantial contact with a dielectric layer; exposing the film bulk acoustic wave resonator to the high energy radiation; determining the resonant frequency of the film bulk acoustic wave resonator; and determining the dose of high energy radiation using the resonant frequency of the film bulk acoustic wave resonator. |
| FILED | Thursday, January 20, 2011 |
| APPL NO | 13/513287 |
| ART UNIT | 2884 — Optics |
| CURRENT CPC | Investigating or Analysing Materials by Determining Their Chemical or Physical Properties G01N 29/036 (20130101) Measurement of Nuclear or X-radiation G01T 1/16 (20130101) Original (OR) Class G01T 1/161 (20130101) G01T 1/1606 (20130101) |
| VIEW PATENT | @ USPTO: Full Text PDF |
Government Rights Acknowledged
| US 08702851 | O'Coin |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | James R. O'Coin (Somers, Connecticut) |
| ASSIGNEE(S) | Hamilton Sundstrand Space Systems International, Inc. (Windsor Locks, Connecticut) |
| INVENTOR(S) | James R. O'Coin (Somers, Connecticut) |
| ABSTRACT | A heat exchanger is provided and includes a frame defining a volumetric body with substantially flat upper and lower sides, heat exchange elements disposed within an interior of the body, sorbent material disposed among the heat exchange elements within the interior of the body, retainer screens disposed at upper and lower sides of the heat exchange elements and sorbent material and structural foam layers supportively disposed between the retainer screens and the substantially flat upper and lower sides to absorb loading applied to the retainer screens. |
| FILED | Friday, March 02, 2012 |
| APPL NO | 13/411098 |
| ART UNIT | 1776 — Chemical Apparatus, Separation and Purification, Liquid and Gas Contact Apparatus |
| CURRENT CPC | Gas separation: Apparatus 096/146 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704705 | Dougherty et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | John Charles Dougherty (Liverpool, New York); Jeffrey John Fontanella (Liverpool, New York) |
| ASSIGNEE(S) | SRC, Inc. (North Syracuse, New York) |
| INVENTOR(S) | John Charles Dougherty (Liverpool, New York); Jeffrey John Fontanella (Liverpool, New York) |
| ABSTRACT | A method, system and computer program product for calibrating and operating a radar apparatus provides for obtaining calibration response data from, for example, a radar cylinder and a plurality of radar columns, prior to assembling the radar cylinder and plurality of radar columns into an assembled radar apparatus. The calibration response data for the exemplary radar cylinder and the plurality of radar columns is evaluated to provide a simulated response of the assembled radar apparatus. Actual measured responses from the assembled radar apparatus may then be correlated with the simulated response through use of a look-up table. The particular method, system and program product for calibrating and operating the radar apparatus provides for avoidance of field calibration of the assembled radar apparatus, which is generally neither desirable nor feasible under hostile conditions. |
| FILED | Wednesday, March 16, 2011 |
| APPL NO | 13/049213 |
| ART UNIT | 3646 — Aeronautics, Agriculture, Fishing, Trapping, Vermin Destroying, Plant and Animal Husbandry, Weaponry, Nuclear Systems, and License and Review |
| CURRENT CPC | Communications: Directive radio wave systems and devices 342/169 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08704977 | Lavrentovich et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Oleg D. Lavrentovich (Kent, Ohio); Yuriy A. Nastyshyn (Lviv, Ukraine); Vassili G. Nazarenko (Kyiv, Ukraine); Roman M. Vasyuta (Kyiv, Ukraine); Oleksandr P. Boiko (Kyiv, Ukraine); Ye Yin (Fremont, California); Sergij V. Shiyanovskii (Stow, Ohio) |
| ASSIGNEE(S) | Kent State University (Kent, Ohio) |
| INVENTOR(S) | Oleg D. Lavrentovich (Kent, Ohio); Yuriy A. Nastyshyn (Lviv, Ukraine); Vassili G. Nazarenko (Kyiv, Ukraine); Roman M. Vasyuta (Kyiv, Ukraine); Oleksandr P. Boiko (Kyiv, Ukraine); Ye Yin (Fremont, California); Sergij V. Shiyanovskii (Stow, Ohio) |
| ABSTRACT | The invention provides a liquid crystal cell and method thereof. The cell comprises two opposed substrates and a surfactant-free lyotropic chromonic liquid crystals (LCLC) material disposed therebetween. By using an ammonium compound with LCLC or surface treatment on the substrates, the alignment of the LCLC material can be manipulated as a homeotropic bulk alignment; or a hybrid bulk alignment in which the LCLC alignment is changed from homeotropic bulk alignment in the vicinity of one substrate to planar alignment in the vicinity of another substrate. The cell can be used in biosensing, detection and amplification of ligands, optical devices, and photovoltaics etc. |
| FILED | Wednesday, March 05, 2008 |
| APPL NO | 12/042638 |
| ART UNIT | 1782 — Miscellaneous Articles, Stock Material |
| CURRENT CPC | Liquid crystal cells, elements and systems 349/84 |
| VIEW PATENT | @ USPTO: Full Text PDF |
| US 08705983 | Logan, Jr. et al. |
|---|---|
| FUNDED BY |
|
| APPLICANT(S) | Ronald T. Logan, Jr. (Pasadena, California); Eva Peral (Altadena, California); Patrick J. Cawthorne (Warminster, Pennsylvania); Gustav Witzel (Warminster, Pennsylvania); Frank Weiss (Warminster, Pennsylvania) |
| ASSIGNEE(S) | Emcore Corporation (Albuquerque, New Mexico) |
| INVENTOR(S) | Ronald T. Logan, Jr. (Pasadena, California); Eva Peral (Altadena, California); Patrick J. Cawthorne (Warminster, Pennsylvania); Gustav Witzel (Warminster, Pennsylvania); Frank Weiss (Warminster, Pennsylvania) |
| ABSTRACT | An optical communication system for generating and transmitting a modulated optical signal in which light emitted by a light source is modulated by an optical modulator in accordance with an input electrical signal. A bias signal generator applies a bias electrical signal to bias the optical modulator at a bias angle away from quadrature. The bias signal generator monitors the input electrical signal and adjusts the applied bias electrical signal in dependence on the input electrical signal. The system further includes a receiver which may include an equalizer coupled to the photodetector of the receiver. |
| FILED | Friday, March 25, 2011 |
| APPL NO | 13/072531 |
| ART UNIT | 2636 — Optical Communications |
| CURRENT CPC | Optical communications 398/198 |
| VIEW PATENT | @ USPTO: Full Text PDF |
How To Use This Page
THE FEDINVENT PATENT DETAILS PAGE
Each week, FedInvent analyzes newly granted patents and published patent applications whose origins lead back to funding by the US Federal Government. The FedInvent Patent Details page is a companion to the weekly FedInvents Patents Report.
This week's information is published in the FedInvent Patents report for Tuesday, April 22, 2014.
The FedInvent Weekly Patent Details Page contains a subset of patent information to provide a deeper dive into the week’s taxpayer-funded patents to help the reader better understand where a patent fits in the federal innovation ecosphere.
HOW IS THE INFORMATION ORGANIZED?
Patents are organized by the funding agency. Within each group, the patents are organized in numeric order. A patent funded by more than one agency will appear in the section of each of the agencies that funded the research and development that resulted in the invention. This approach gives the reader a complete view of the department or agency activity for the week.
WHAT INFORMATION WILL I FIND?
THE PANEL
There is a panel for each patent that contains the patent number and the title of the patent. When you click the panel, it opens to reveal the following information:
FUNDED BY
The agencies that funded the grants, contracts, or other research agreements that resulted in the patent. FedInvent includes as much information on the source of the funding as possible. The information is presented in a hierarchy going from the Federal Department down to the agencies, subagencies, and offices that funded the work. Here are two examples:
Department of Health and Human Services (HHS)
National Institutes of Health (NIH)
National Institute of Diabetes and Digestive and Kidney Diseases (NIDDK)
Department of Defense (DOD)
Defense Advanced Research Projects Agency (DARPA)
Army Research Office (ARO)
We do our best to provide detailed information about the funding. In some cases, the patent only reports limited information on the origins of the funding. FedInvents presents what it can confirm. We add the patents without the information required by the Bayh-Dole Act to our list of patents worthy of further investigation.
APPLICANT(S) and ASSIGNEES
FedInvent includes both the Applicants and the Assignees because having both provides more information about where the inventive work was done and by what organizations. Many organizations — universities, corporations, and federal agencies — standardize the Assignee/Owner information by the time a patent is granted. In the case of federal patents, many of the patents use the agency headquarters information for patent assignment.
Showing just the headquarters address would make Washington, DC the epicenter of all taxpayer-funded research and development. Providing both the applicant information and the assignee information provides a more accurate picture of where important taxpayer funded innovation is happening in America. Here are two examples from two different patents:
APPLICANT: U.S. Army Research Laboratory, Adelphi, MD
ASSIGNEE: The United States of America as represented by the Secretary of the Army Washington, DC
APPLICANT: Optech Ventures, LLC (Torrance, California)
ASSIGNEE(S): The Regents of the University of California (Oakland, California); Optech Ventures, LLC (Torrance, California)
INVENTOR(S)
The inventors appear in the same order as they appear on the patent. FedInvents presents the names in first name/last name order because they are easier to read than the last name/first name order of the names on the USPTO patent documents.
ABSTRACT
The abstract as it appears on the patent.
FILED
The date of the patent application including the day of the week.
APPL NO
This is the patent application serial number. If you’d like to learn more about how application serial numbers work you can go to the Lists Page.
ART UNIT
Patent data includes the Art Unit where a patent was examined. (The Art Unit isn’t available for published patent applications.) The Art Unit provides insight into what group of patent examiners prosecuted the patent application and the subject matter that the examiners work on. For example:
3793 — Medical Instruments, Diagnostic Equipment, and Treatment Devices
You can learn more about ART UNITS on the FedInvent Patents Weekly panel called About Tech Center or you can find information on the FedInvent Lists Page.
CURRENT CPC
Current CPC provides a list of the Cooperative Patent Classification symbols assigned to the patent. These are the CPC symbols assigned at the time the patent was granted.
The FedInvent Project is a patent classification maximalist endeavor or put another way, we believe that more you understand about patent classification the more you'll learn about the nature of the invention and the types of work that the federal government is funding.
The symbol presented in BOLD is the symbol identified as the "first" classification which is the most relevant classification on the patent. The date that follows the symbol is the date of the most recent revision to the art classed there.
- A61B 1/149 (20130101)
- A61B 1/71 (20130101)
- A61B 1/105 (20130101)
The CPC symbols match the classifications found on the PDF version of the patent. Over time, the classifications on the full-text version of the patent change to reflect how USPTO organizes patent art to support its examiners. The two sets of CPCs don’t always match.
VIEW PATENT
As of June 2021, we include two ways to view a patent at USPTO. FedInvent provides a link to the Full-Text Version of the patent and a link to the PDF version of the patent.
HOW DO I FIND A SPECIFIC PATENT ON A PAGE?
You can use the Command F or Control F to find a specific patent you are interested in.
HOW DO I GET HERE?
You navigate to the details of a patent by clicking the information icon that follows a patent on the FedInvent Patents Weekly Report.
You can also reach this page using the weekly page link that looks like this:
https://wayfinder.digital/fedinvent/patents-2014/fedinvent-patents-20140422.html
Just update the date portion of the URL. Tuesdays for patents. Thursdays for pre-grant publication of patent applications.
Download a copy of the How To Use This Page